DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and grik1a

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_009303592.1 Gene:grik1a / 798001 ZFINID:ZDB-GENE-030131-6502 Length:919 Species:Danio rerio


Alignment Length:267 Identity:58/267 - (21%)
Similarity:102/267 - (38%) Gaps:80/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 DIKDG-DLWDVFPRRLKNLHGCPLSVIVWDI--PPYMRINWKSSDP-MDGLDGLDGL---LLRIV 247
            :|||. ::.|....|         ::||..|  .||  :.:|.||. :.|.|..:|.   ||:.:
Zfish   433 EIKDNKNITDSLANR---------TLIVTTILENPY--VMYKKSDKVLYGNDRFEGYCLDLLKEL 486

  Fly   248 ARKMNFT--LKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSP 310
            :..:.||  :||:   .:|..|..: ..|.:.|..:.|.:..|::.:.....|..|...::.:.|
Zfish   487 SNILGFTYEVKLV---TDGKYGAQN-DKGEWNGMVRELIDHIADLAVAPLTITYVREKVIDFSKP 547

  Fly   311 YSQMS--------------------------YIIVLQARGGYSIYEVMLFPFEKYTW-------- 341
            :..:.                          ::.||.|..|.|....::..|..|.|        
Zfish   548 FMTLGISILYRKPNGTNPGVFSFLNPLTPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP 612

  Fly   342 ----------LLLSTILGLHWIV--GSRWRMP----SPILAG-WMLWIFVIRASYEASVFNFI-- 387
                      ||.|...|:..::  ||. .||    :.||.| |..:..:|.:||.|::..|:  
Zfish   613 SSEVVENNFTLLNSLWFGVAALMRQGSE-LMPKALSTRILGGIWWFFTLIIISSYTANLAAFLTV 676

  Fly   388 --QNSPV 392
              .:||:
Zfish   677 ERMDSPI 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
grik1aXP_009303592.1 Periplasmic_Binding_Protein_Type_1 37..432 CDD:299141
ANF_receptor 57..398 CDD:279440
Periplasmic_Binding_Protein_Type_2 446..815 CDD:304360 54/254 (21%)
Lig_chan 577..846 CDD:278489 27/108 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.