Sequence 1: | NP_001138175.1 | Gene: | Ir7d / 7354416 | FlyBaseID: | FBgn0259190 | Length: | 594 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009303592.1 | Gene: | grik1a / 798001 | ZFINID: | ZDB-GENE-030131-6502 | Length: | 919 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 58/267 - (21%) |
---|---|---|---|
Similarity: | 102/267 - (38%) | Gaps: | 80/267 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 DIKDG-DLWDVFPRRLKNLHGCPLSVIVWDI--PPYMRINWKSSDP-MDGLDGLDGL---LLRIV 247
Fly 248 ARKMNFT--LKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSP 310
Fly 311 YSQMS--------------------------YIIVLQARGGYSIYEVMLFPFEKYTW-------- 341
Fly 342 ----------LLLSTILGLHWIV--GSRWRMP----SPILAG-WMLWIFVIRASYEASVFNFI-- 387
Fly 388 --QNSPV 392 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir7d | NP_001138175.1 | None | |||
grik1a | XP_009303592.1 | Periplasmic_Binding_Protein_Type_1 | 37..432 | CDD:299141 | |
ANF_receptor | 57..398 | CDD:279440 | |||
Periplasmic_Binding_Protein_Type_2 | 446..815 | CDD:304360 | 54/254 (21%) | ||
Lig_chan | 577..846 | CDD:278489 | 27/108 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |