Sequence 1: | NP_001138175.1 | Gene: | Ir7d / 7354416 | FlyBaseID: | FBgn0259190 | Length: | 594 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138274.1 | Gene: | si:ch211-251b21.1 / 571720 | ZFINID: | ZDB-GENE-060809-5 | Length: | 458 | Species: | Danio rerio |
Alignment Length: | 335 | Identity: | 64/335 - (19%) |
---|---|---|---|
Similarity: | 102/335 - (30%) | Gaps: | 121/335 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 PLSVIVWDIPPYMRINWKSSDPMDGLDGLDGLLLRIVARKMNF--TLKLIPNEPNGLIGGSSFMN 273
Fly 274 GTFTGAYKMLRE---RRANITIGCAACTPERSTFLEATSPYSQ--MSYIIVLQARGGYSIYEVML 333
Fly 334 FPFEKYTWL--------------LLSTILGLHW-----------IVGSRWRM----------PSP 363
Fly 364 -ILAGWML----WIF--VIRASY-----------------------------------EASVFNF 386
Fly 387 IQNSPVKPSPRTLD-----------------QALSGGFRFITDHAS-------YRMTLKIPSFQG 427
Fly 428 KTLISAGQPV 437 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir7d | NP_001138175.1 | None | |||
si:ch211-251b21.1 | NP_001138274.1 | PBP2_iGluR_non_NMDA_like | 25..375 | CDD:270403 | 63/334 (19%) |
Lig_chan | 146..396 | CDD:278489 | 34/200 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170596333 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |