DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and si:ch211-251b21.1

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001138274.1 Gene:si:ch211-251b21.1 / 571720 ZFINID:ZDB-GENE-060809-5 Length:458 Species:Danio rerio


Alignment Length:335 Identity:64/335 - (19%)
Similarity:102/335 - (30%) Gaps:121/335 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PLSVIVWDIPPYMRINWKSSDPMDGLDGLDGLLLRIVARKMNF--TLKLIPNEPNGLIGGSSFMN 273
            ||.|......||...  |.|:    |:|....:|..::.|:.|  .:.|:.:...|....|...|
Zfish    24 PLKVTTIKEEPYAMS--KGSE----LEGFCIDMLSAISNKLGFKYDVHLVKDGRYGKTDDSGNWN 82

  Fly   274 GTFTGAYKMLRE---RRANITIGCAACTPERSTFLEATSPYSQ--MSYIIVLQARGGYSIYEVML 333
            |       |:.|   ..|:|.:.....|.:|...::.:.|:.|  :|:|:........|.:..:|
Zfish    83 G-------MIGEVVRGEADIAVAPLTLTAQREAVVDMSKPFMQTGLSFIMRKDLGSDDSQFLSLL 140

  Fly   334 FPFEKYTWL--------------LLSTILGLHW-----------IVGSRWRM----------PSP 363
            ..|....|:              |:|.|....|           :..|.|..          |.|
Zfish   141 KLFSTEMWMGVLVAYLLTSICIFLVSRISPCEWEQPEKDNNSFTLSHSFWYTVGALTLQGAGPHP 205

  Fly   364 -ILAGWML----WIF--VIRASY-----------------------------------EASVFNF 386
             .|:|.::    |||  |:.|.|                                   ::|.|||
Zfish   206 KALSGRVITSIWWIFSLVLLACYFANLSLWLHSDNQQLSIKTFEDLANQNVIEYGTIKDSSSFNF 270

  Fly   387 IQNSPVKPSPRTLD-----------------QALSGGFRFITDHAS-------YRMTLKIPSFQG 427
            .:||......|..:                 :|..|.:.||.:..|       |....:.|...|
Zfish   271 FKNSNNPTYHRIYEHIKEAQSYSLNAAEGFRRAQKGNYAFIGESVSLDLAVARYCNLTRAPEIIG 335

  Fly   428 KTLISAGQPV 437
            ....|...|:
Zfish   336 MRGYSIAAPL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
si:ch211-251b21.1NP_001138274.1 PBP2_iGluR_non_NMDA_like 25..375 CDD:270403 63/334 (19%)
Lig_chan 146..396 CDD:278489 34/200 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.