DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and grin3a

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_009303361.1 Gene:grin3a / 564832 ZFINID:ZDB-GENE-130530-780 Length:1111 Species:Danio rerio


Alignment Length:482 Identity:97/482 - (20%)
Similarity:156/482 - (32%) Gaps:136/482 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VFPRRLKNLHGCPLSVIVWDIPPYMRINWKSSDPMDGLDGLDGL---------------LLRIVA 248
            ||.|.:.:...||...:..|  |.............||.|.:..               ||..:|
Zfish   532 VFTRDVDDEGLCPAGQLCLD--PLTNDTALLESLFQGLQGANDTVPLEFKKCCYGYCIDLLEKLA 594

  Fly   249 RKMNFTLKLIPNEPNGLIGG---SSFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSP 310
            ..|.|...|.      ::|.   .::.||.:||....|....|::.:...:....||..::.|||
Zfish   595 EDMGFDFDLY------IVGDGKYGAYKNGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTSP 653

  Fly   311 YSQMSYIIVLQARGGYSIYEVMLFPFEKYTWLLLSTILGLH----WIVGSRWRMP---SP----- 363
            :...|..|:::.|...:.....::|.....|  |...:.||    ::....|:.|   :|     
Zfish   654 FFSTSLGILVRTRDTAAPIGAFMWPLHWSMW--LGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNR 716

  Fly   364 ---------------ILAG-------------------WMLWIFVIRASYEASVFNFIQNSPVKP 394
                           ||.|                   |.::.....::|.|::      :.|..
Zfish   717 DRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANL------AAVMV 775

  Fly   395 SPRTLDQALSG-----------GFRFITDHASYRMTLKIPSF----QGKTLISAGQPVDVFDALL 444
            ..:|.:| |||           ||||.|...|........||    :.....:|....|..|.|.
Zfish   776 GEKTYEQ-LSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPTTPDGIDHLK 839

  Fly   445 KAPWKTGAFTSRAFLADHLVRHRKHRNQLVILAEKIVDNMLCMYFPHG----SYFAWEINKLLFN 505
            ..|.|..||.....|.|:...           |:|...::|...:..|    |.....|::|:..
Zfish   840 DDPQKLDAFIMDKALLDYWAH-----------ADKXYISLLLTGYGIGLKQNSPLTSNISELVSQ 893

  Fly   506 MRSFGIFQH-HSQILAWDNLPTTTDTDTP-GKRIHSSTESVATGFAE-SMSFVVAALNCLMGALC 567
            .:|.|.... |.:   |..:       .| |||..:.||::..|... |..||:         ||
Zfish   894 YKSDGFMDMLHDK---WYKV-------VPCGKRSFAVTETLQMGIKHFSGLFVM---------LC 939

  Fly   568 ISIVVFGLELLSRRRHWTGLEWLFERV 594
            :.:   .|.||:.........|:..|:
Zfish   940 VGV---ALSLLTTLGEHIVHRWVIPRM 963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
grin3aXP_009303361.1 Periplasmic_Binding_Protein_Type_1 36..502 CDD:299141
ANF_receptor 132..452 CDD:279440
PBP2_iGluR_NMDA_Nr3 518..908 CDD:270438 79/406 (19%)
Lig_chan 682..941 CDD:278489 60/297 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.