DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and grik2

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_021322472.1 Gene:grik2 / 556013 ZFINID:ZDB-GENE-080414-1 Length:908 Species:Danio rerio


Alignment Length:241 Identity:52/241 - (21%)
Similarity:92/241 - (38%) Gaps:65/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SVIVWDI--PPYMRINWKSSDPMDGLDGLDGL---LLRIVARKMNF--TLKLIPNEPNGLIGGSS 270
            |::|..|  .||:... ||..|:.|.|..:|.   |||.:|..:.|  .|:|:   .:|..|...
Zfish   432 SLVVSTILEEPYVMFK-KSDKPLYGNDRFEGYCVDLLRELAAILGFGYELRLV---EDGRYGAQD 492

  Fly   271 FMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMS-------------------- 315
            ..:|.:.|..:.|.:.:|::.:...|.|..|...::.:.|:..:.                    
Zfish   493 ESSGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLN 557

  Fly   316 ------YIIVLQARGGYSIYEVMLFPFEKYTWLLLS-------------TILGLHWI-VGSRWR- 359
                  ::.:|.|..|.|....::..|..|.|....             |:|...|. ||:..: 
Zfish   558 PLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQ 622

  Fly   360 ----MPSPI---LAGWMLWIF--VIRASYEASVFNFI----QNSPV 392
                ||..:   :.|.:.|.|  :|.:||.|::..|:    ..||:
Zfish   623 GSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPI 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
grik2XP_021322472.1 PBP1_iGluR_Kainate 37..414 CDD:380605
Periplasmic_Binding_Protein_Type_2 430..800 CDD:419667 52/241 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.