DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Grik2

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_062182.1 Gene:Grik2 / 54257 RGDID:2733 Length:908 Species:Rattus norvegicus


Alignment Length:241 Identity:55/241 - (22%)
Similarity:94/241 - (39%) Gaps:65/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SVIVWDI--PPYMRINWKSSDPMDGLDGLDGL---LLRIVARKMNFT--LKLIPNEPNGLIGGSS 270
            |:||..|  .||:... ||..|:.|.|..:|.   |||.::..:.||  ::|:   .:|..|...
  Rat   432 SLIVTTILEEPYVLFK-KSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLV---EDGKYGAQD 492

  Fly   271 FMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMS-------------------- 315
            .:||.:.|..:.|.:.:|::.:...|.|..|...::.:.|:..:.                    
  Rat   493 DVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLN 557

  Fly   316 ------YIIVLQARGGYSIYEVMLFPFEKYTWLLLS-------------TILGLHWI-VGSRWR- 359
                  ::.||.|..|.|....::..|..|.|....             |:|...|. ||:..| 
  Rat   558 PLSPDIWMYVLLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMRQ 622

  Fly   360 ----MPSPI---LAGWMLWIF--VIRASYEASVFNFI----QNSPV 392
                ||..:   :.|.:.|.|  :|.:||.|::..|:    ..||:
  Rat   623 GSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPI 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
Grik2NP_062182.1 Periplasmic_Binding_Protein_Type_1 34..414 CDD:299141
ANF_receptor 52..395 CDD:279440
Periplasmic_Binding_Protein_Type_2 430..800 CDD:304360 55/241 (23%)
Glutamate binding. /evidence=ECO:0000269|PubMed:15721240, ECO:0000269|PubMed:17115050, ECO:0007744|PDB:1S50, ECO:0007744|PDB:1S7Y, ECO:0007744|PDB:2I0B, ECO:0007744|PDB:2I0C 516..518 0/1 (0%)
Lig_chan 562..831 CDD:278489 26/107 (24%)
Glutamate binding. /evidence=ECO:0000269|PubMed:15721240, ECO:0000269|PubMed:17115050, ECO:0007744|PDB:1S50, ECO:0007744|PDB:1S7Y, ECO:0007744|PDB:2I0B, ECO:0007744|PDB:2I0C 689..690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.