DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and grin2da

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_009292354.1 Gene:grin2da / 449864 ZFINID:ZDB-GENE-041008-124 Length:1916 Species:Danio rerio


Alignment Length:253 Identity:53/253 - (20%)
Similarity:94/253 - (37%) Gaps:71/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WDVFPRRLKNLHGCP-LSVIVWDIPPYMRINWKSSDPMDG------------------LDGLDGL 242
            |..:...||.|.... |.|:..:..|::.:  :.:||..|                  ::|:..:
Zfish   439 WSRYGPFLKPLDDSQHLRVVTLEERPFVIV--EPADPGTGSCIRDSVPCRLPLNNSMVVEGIQSM 501

  Fly   243 ----------LLRIVARKMNFT--LKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCA 295
                      :|:.:|:.:.||  |.|:.|..:|     ..::|.:.|....:..:||::.||..
Zfish   502 KHCCKGFCIDVLKRLAKIVGFTYDLYLVTNGRHG-----KNIDGQWNGMVGEVVSKRADMAIGSL 561

  Fly   296 ACTPERSTFLEATSPYSQMSYIIVLQARGGYSIYEVMLFPFEKYTWLL-----LSTILGLHWI-- 353
            ....|||..:|.:.|:.:....:::....|.......|.|:....|::     ||.:....:|  
Zfish   562 TINEERSEVVEFSVPFVETGISVMVSRSNGTVSPSAFLEPYSPAVWVMMFVMCLSVVAVTVFIFE 626

  Fly   354 ----VGSRWRMPSPILAG----------WMLWIFVIRASYEASVFNFIQNSPVKPSPR 397
                ||....:.|...||          |:||         |.|||   ||....:||
Zfish   627 FFSPVGYNRSLQSGKTAGGSKFTIGKSIWLLW---------ALVFN---NSVPVENPR 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
grin2daXP_009292354.1 PBP1_iGluR_NMDA_NR2 42..441 CDD:107373 1/1 (100%)
PBP2_iGluR_NMDA_Nr2 452..851 CDD:270436 49/240 (20%)
HisJ <507..>590 CDD:223904 19/87 (22%)
Lig_chan 605..877 CDD:278489 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.