DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Ir87a

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:340 Identity:67/340 - (19%)
Similarity:110/340 - (32%) Gaps:137/340 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 SCSSLEPVEI--DIKDGDLWDVFPRRLKNLHGCPLSVIVWDIPPYMRINWKSSDPMD----GLDG 238
            |.:|.||..|  :.......|.|||   :|.||||:.......||:..| ....|:|    ||.|
  Fly   305 SSNSSEPEAIIEEFFRAKFEDKFPR---DLSGCPLTASFRPWEPYIFRN-SEEQPVDDYYYGLQG 365

  Fly   239 -------------------------------------------LDGL---LLRIVARKMNFTLKL 257
                                                       |.|:   :::.:|.:::.::: 
  Fly   366 DEDDYNDTSPNYGESDDESYADPGEDGDGAIPDTETQSGGKLKLSGIEYEMVQTIAERLHVSIE- 429

  Fly   258 IPNEPNGLIGGSSFMNGTFTGAY---KMLRERRANITIGCAACTPERSTFLEATSPYSQ--MSYI 317
                          |.|..:..|   :.|.:....:.:|.....|..|.|:.::.||.|  :::.
  Fly   430 --------------MQGENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQFVSSSIPYHQDELTWC 480

  Fly   318 IV-LQARGGYSIYEVMLFPFEKYTWLLLSTILGLHWIVGSRWRMPSPILAGWMLWIFVIRASYEA 381
            :. .:.|.|:..: |..|..:                            ||:::.|||:..|...
  Fly   481 VARAKRRHGFFNF-VATFNAD----------------------------AGFLIGIFVVTCSLVV 516

  Fly   382 ----------------------SVFNFIQNS--PVKPSPRTLDQ--ALS--GGFRFITDHASYRM 418
                                  .|...:.|.  |.:..|.||.|  |||  .||.|...:.|:.:
  Fly   517 WLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQDFPITLRQLFALSFLMGFFFSNTYQSFLI 581

  Fly   419 -TLKIP--SFQGKTL 430
             ||..|  |:|..||
  Fly   582 STLTTPRSSYQIHTL 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 13/81 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.