DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Ir67b

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster


Alignment Length:353 Identity:63/353 - (17%)
Similarity:129/353 - (36%) Gaps:93/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LQKIFINGLAVYNFGVFISTSYEEMDRDRVILVHQVLNRNLYPPNFPVAVVLASKMNRKITAQ-V 102
            ::.:::|.|          .|...::.:|::...|.|| |:|.....|.:...:..:...:|| .
  Fly     1 MELLYLNTL----------QSLSLLEGNRLVQTVQELN-NIYQTELNVFLEFGNGADILESAQGT 54

  Fly   103 FTQLLFVQNAEQAIAIAEGVNRNGLCVIVLLTSQPERPI-------------------------- 141
            |...|:::|.:....:........|.::.|.....:|.:                          
  Fly    55 FVPTLWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYDK 119

  Fly   142 MTKIFTYFMQERYNINVVILVPRLHGVQAFNVRPYTPTSCSSLEPVEIDIKDGDLWDVFPRRLKN 206
            :.:||:....|.: :||::::|....:..|  .||......:|:.::      :.:.: .|:..:
  Fly   120 LIQIFSRCFNEGF-VNVLVMLPGSDELYTF--MPYQDLKILNLKSIK------EFYSL-SRKKMD 174

  Fly   207 LHGCPLS--VIVWDIPPYMRINWKSSDPMDGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGS 269
            |:|..::  :::...|     .|.|.........|.|.:||::   ::||     |..||.:   
  Fly   175 LNGYNITSGLVIAGAP-----RWFSFRDRQNRLILTGYMLRMI---VDFT-----NHFNGSV--- 223

  Fly   270 SFMNG-TFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVLQARG-------GY 326
            ..||. |.....::|    ||.||       :...||........||.|:.|:..|       ..
  Fly   224 RLMNVLTVNDGLELL----ANRTI-------DFFPFLIRPLKSFSMSNILYLENCGLIVPTSRPL 277

  Fly   327 SIYEVMLFPFEKYTWLLLSTILGLHWIV 354
            ..:..:|.|:...||:.        |::
  Fly   278 PNWVYLLRPYAFDTWIA--------WLI 297



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.