DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Ir64a

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster


Alignment Length:428 Identity:80/428 - (18%)
Similarity:135/428 - (31%) Gaps:161/428 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 WKSSDPMDGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANIT 291
            ::.|.|:|.     |.|.:...:|:|                            |.:::|:|.  
  Fly   523 YEDSTPIDA-----GTLWQRCYQKLN----------------------------KYIKDRKAK-- 552

  Fly   292 IGCAACTPER-STFLEATSPYSQMSYI-IVLQARGGYSIYEVMLFPFEKYTWLLLSTILGLHWIV 354
               ....||| ..|||     |.:.:: |:.|...|:|                .|.:.|...::
  Fly   553 ---QKKAPERVGLFLE-----SVLFFVGIICQQGLGFS----------------TSFVSGRCIVI 593

  Fly   355 GSRWRMPSPILAGWMLWIFVIRASYEASVF-NFIQNSP--VKPSPRTLDQALSGGFRFITDHASY 416
            .|            :|:.|.|...|.||:. ..:...|  :|.....:..:|..|...|..:..|
  Fly   594 TS------------LLFSFCIYQFYSASIVGTLLMEKPKTIKTLSDLVHSSLKVGMEDILYNRDY 646

  Fly   417 RMTLKIP---SFQGKTLISA----------GQPVDVFDALLKAPWK----------TGAFTSR-- 456
            .:..|.|   ....|.:.|.          .:|||. :.:...|.|          |||....  
  Fly   647 FLHTKDPVSMELYAKKITSVPTTKENEADEDEPVDP-NPVSTDPAKSYRDIVHSHETGAHAKDNA 710

  Fly   457 -----------------AFLADHLVRHRKHRNQLVILAEKIVDNMLC------MYFPHGSYFAWE 498
                             ||..|....::       |:||...:..:|      |:.|..:....:
  Fly   711 ASNWLDPETGLLRHLGFAFHVDVAAAYK-------IIAETFSEQDICDLTEVSMFPPQKTVSIMQ 768

  Fly   499 INKLLFNMRSF--------GIFQHHSQILAW-DNLPTTTDTDTPGKRIHSSTESVATGFAESMSF 554
            .|..:..:.|:        ||..:|..:  | ...|...      |:|.:|...|      .|..
  Fly   769 KNSPMRKVISYGLRRVTETGILTYHFNV--WHSRKPPCV------KKIETSDLHV------DMDT 819

  Fly   555 VVAALNCLMGALCISIVVFGLELLSRRRH------WTG 586
            |.:||..|:.:..|::::.|.|:|..:.|      |.|
  Fly   820 VSSALLILLFSYAITLMILGTEILYSKWHNRIQLKWVG 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360
Lig_chan 563..828 CDD:278489 59/319 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462959
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.