DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Ir56b

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:350 Identity:73/350 - (20%)
Similarity:120/350 - (34%) Gaps:91/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 NITIGCAACTPER-STFLEATS---PYSQMSYIIVLQARGGYSIYEVMLFPFEKYTW--LLLSTI 347
            |:::......||. |.|..||.   |...|:..:::........:..|::|..||.|  |.|.|.
  Fly    79 NLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTF 143

  Fly   348 ---LGLHWIVGSRWRMPS-----------------------------------PILAGWMLWIF- 373
               |.|.::   .||.|.                                   .|:...:|:|| 
  Fly   144 YVALLLRYV---HWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFG 205

  Fly   374 VIRASYEASVFNFIQNSPV--KPSPRTLDQALSGGFRFITDHASYRMTLKIPSFQGKTLISAGQP 436
            .|..:|..|........||  :|.....|..          |:..|:.:.      .:|:...:.
  Fly   206 FILTNYHLSHMTAFDMKPVFLRPIDTWSDLI----------HSRLRIVIH------DSLLEELRW 254

  Fly   437 VDVFDALLKAPWKTGAF--TSRAFLADHLVRHRKHRNQLVIL-----AEKIVDNMLCMYFPHGS- 493
            :.|:.|||.:|.::.|:  |..|:|.       .:|.|.|::     ..|:....|....|..| 
  Fly   255 LPVYQALLASPSRSYAYVVTQDAWLF-------FNRQQKVLIQPYFHLSKVCFGGLFNALPMASN 312

  Fly   494 -YFAWEINKLLFNMRSFGIFQHHSQILAWDNLPTTTDTDTPGKRIHSSTESVATGFAESMSFVVA 557
             .||..:||.:.|:...|::.:      |:.|...........::...|..|.   ..::.|...
  Fly   313 ASFADSLNKFILNVWQAGLWNY------WEELAFRYAEQAGYAKVFLDTYPVE---PLNLEFFTT 368

  Fly   558 ALNCLMGALCISIVVFGLELLSRRR 582
            |...|...:.||.:.|.|||...||
  Fly   369 AWIVLSAGIPISSLAFCLELFIHRR 393



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.