DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Grik3

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001106187.1 Gene:Grik3 / 298521 RGDID:71027 Length:919 Species:Rattus norvegicus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:112/298 - (37%) Gaps:77/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SVIVWDI--PPYMRINWKSSDPMDGLDGLDGL---LLRIVARKMNFT--LKLIPNEPNGLIGGSS 270
            |:||..:  .|::... ||...:.|.|..:|.   ||:.:|..:.|:  ::|:   .:|..|...
  Rat   435 SLIVTTLLEEPFVMFR-KSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLV---EDGKYGAQD 495

  Fly   271 FMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMS-------------------- 315
             ..|.:.|..|.|.:.:|::.:.....|..|...::.:.|:..:.                    
  Rat   496 -DKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLN 559

  Fly   316 ------YIIVLQARGGYSIYEVMLFPFEKYTWLLLS-------------TILGLHWI-VGSRWR- 359
                  ::.||.|..|.|....::..|..|.|....             |:|...|. :||..: 
  Rat   560 PLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQ 624

  Fly   360 ----MPSPI---LAGWMLWIF--VIRASYEASVFNFI----QNSPVKPSPRTLDQALSGGFRFIT 411
                ||..:   :.|.:.|.|  :|.:||.|::..|:    ..||: .|...|.:.....:..:.
  Rat   625 GSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPI-DSADDLAKQTKIEYGAVK 688

  Fly   412 DHASYRMTL----KIPSFQGKTLISAGQPVDVFDALLK 445
            |.|:  ||.    ||.:|:......:.:|    .||:|
  Rat   689 DGAT--MTFFKKSKISTFEKMWAFMSSKP----SALVK 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
Grik3NP_001106187.1 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 62/298 (21%)
Lig_chan 564..832 CDD:278489 38/164 (23%)
Glutamate binding 690..692 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.