DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and GRIK1

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001317923.1 Gene:GRIK1 / 2897 HGNCID:4579 Length:949 Species:Homo sapiens


Alignment Length:231 Identity:49/231 - (21%)
Similarity:85/231 - (36%) Gaps:64/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PYMRINWKSSDPMDGLDGLDGLLLRIVARKMN-----FTLKLIPNEPNGLIGGSSFMNGTFTGAY 280
            ||:... ||..|:.|.|..:|..|.::....|     :.:||:   |:|..|..: ..|.:.|..
Human   458 PYVMYR-KSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLV---PDGKYGAQN-DKGEWNGMV 517

  Fly   281 KMLRERRANITIGCAACTPERSTFLEATSPYSQMS--------------------------YIIV 319
            |.|.:.||::.:.....|..|...::.:.|:..:.                          ::.|
Human   518 KELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYV 582

  Fly   320 LQARGGYSIYEVMLFPFEKYTWLLLS-------------TILGLHWI-VGSRWR-----MPSPI- 364
            |.|..|.|....::..|..|.|....             |:|...|. ||:..:     ||..: 
Human   583 LLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALS 647

  Fly   365 --LAGWMLWIF--VIRASYEASVFNFI----QNSPV 392
              :.|.:.|.|  :|.:||.|::..|:    ..||:
Human   648 TRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPI 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
GRIK1NP_001317923.1 Periplasmic_Binding_Protein_Type_1 35..430 CDD:324556
Periplasmic_Binding_Protein_Type_2 446..815 CDD:328725 49/231 (21%)
Glutamate binding. /evidence=ECO:0000250 531..533 0/1 (0%)
Glutamate binding. /evidence=ECO:0000250 704..705
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.