DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and GRIA1

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001244950.1 Gene:GRIA1 / 2890 HGNCID:4571 Length:916 Species:Homo sapiens


Alignment Length:446 Identity:77/446 - (17%)
Similarity:152/446 - (34%) Gaps:114/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PYMRINWKSSDPMDGLDGLDGLLLRI---VARKMNFTLKL-IPNEPNGLIGGSSFMNGTFTGAYK 281
            ||:.:. |:::..:|.|..:|..:.:   :|:.:.::.:| |.::  |..|........:.|...
Human   428 PYVMLK-KNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSD--GKYGARDPDTKAWNGMVG 489

  Fly   282 MLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVL----QARGG---------YSIYEVML 333
            .|...||::.:.....|..|...::.:.|:..:...|::    :::.|         |.|:..::
Human   490 ELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV 554

  Fly   334 FPF--EKYTWLLLSTILGLHW---------------------IVGSRW---------------RM 360
            |.:  ......|:|......|                     |..|.|               |.
Human   555 FAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRS 619

  Fly   361 PSPILAGWMLWIF--VIRASYEASVFNFIQ-NSPVKPSPRTLDQALSGGFRFITDHAS-----YR 417
            .|..:.|.:.|.|  :|.:||.|::..|:. ...|.|.....|.|......:.|..|.     :|
Human   620 LSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFR 684

  Fly   418 MTLKIPSFQGK-TLISAGQPVDVFDALLKAPWKTGAFTSRAFLADHLVRHRKHRNQLVILAEKIV 481
            .: ||..|:.. |.:.:.:| .||....:               :.::|.||.:.:...|.|..:
Human   685 RS-KIAVFEKMWTYMKSAEP-SVFVRTTE---------------EGMIRVRKSKGKYAYLLESTM 732

  Fly   482 DNML-----C---------------MYFPHGSYFAWEINKLLFNMRSFGIFQHHSQILAWDNLPT 526
            :..:     |               :..|.||.....:|..:..:...|:.........:|.   
Human   733 NEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDK--- 794

  Fly   527 TTDTDTPGKRIHSSTESVATGFAESMSFVVAALNCLMGALCISIVVFGLELLSRRR 582
                   |:......:|.....|.|:|.|......|:|.|.::::|..:|...:.|
Human   795 -------GECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSR 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
GRIA1NP_001244950.1 PBP1_iGluR_AMPA_GluR1 36..399 CDD:107385
ANF_receptor 47..382 CDD:279440
PBP2_iGluR_AMPA_GluR1 416..797 CDD:270447 66/398 (17%)
Lig_chan 548..827 CDD:278489 52/305 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.