DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Grik5

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_006228444.1 Gene:Grik5 / 24407 RGDID:2735 Length:980 Species:Rattus norvegicus


Alignment Length:446 Identity:91/446 - (20%)
Similarity:159/446 - (35%) Gaps:122/446 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PYM--RINWKSSDPMDGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGSSFMNGTFTGAY-KM 282
            ||:  |.|:::....:..:|....:||.:|..:.|..:|...| :||.|... .||::||.. ::
  Rat   426 PYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVE-DGLYGAPE-PNGSWTGMVGEL 488

  Fly   283 LRERRANITIGCAACTPERSTFLEATSPYSQMS----YIIVLQARGGYSIYEVMLFPFEKYTWLL 343
            :..::|::.:.....|.||...::.:.|:..:.    |.:.:..:.||..:   |.||....||.
  Rat   489 INRQKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSF---LDPFSPAVWLF 550

  Fly   344 L-------STILGLHWIVGSR-----WRMPSPILAG----------------------------- 367
            :       |.:|    .:.:|     |..|.|.|..                             
  Rat   551 MLLAYLAVSCVL----FLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEI 611

  Fly   368 -------------WMLWIFVIRASYEASVFNFI----QNSPVKPSPRTLDQALSGGFRFITDHAS 415
                         |..:..:|.:||.|::..|:    ...||:.:....||.   ...:.|.||.
  Rat   612 MPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQT---NIEYGTIHAG 673

  Fly   416 YRMTLKIPSFQGK---------TLISAGQPVDVFDALLKAPWK--TGAFTSR-AFLADHLVR--H 466
            ..||.    ||..         ..:.:.|| .||   :|:..:  .....|| |||.:..:.  |
  Rat   674 STMTF----FQNSRYQTYQRMWNYMQSKQP-SVF---VKSTEEGIARVLNSRYAFLLESTMNEYH 730

  Fly   467 RKHRNQLVILAEKIVDNMLCMYFPHGSYFAWEINKLLFNMRSFGIFQHHSQILA---WDNLPTTT 528
            |:....|..:...:......:..|.||.|..||...:..::.    .:..:||.   |:      
  Rat   731 RRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQE----NNRLEILKRKWWE------ 785

  Fly   529 DTDTPGKRIHSSTESVATGFA-ESMSFVVAALNCLMGALCISIVVFGLELL-SRRR 582
                 |.|.....:..|.|.. |::..:...|.|   .|.|::.|..:|.: |.||
  Rat   786 -----GGRCPKEEDHRAKGLGMENIGGIFVVLIC---GLIIAVFVAVMEFIWSTRR 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
Grik5XP_006228444.1 PBP1_iGluR_Kainate_KA1_2 23..401 CDD:380616
Periplasmic_Binding_Protein_Type_2 414..785 CDD:389745 76/382 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.