DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and glr-8

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001368711.1 Gene:glr-8 / 180924 WormBaseID:WBGene00001619 Length:547 Species:Caenorhabditis elegans


Alignment Length:279 Identity:54/279 - (19%)
Similarity:112/279 - (40%) Gaps:63/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 LKNLHGCPLSVIVWDI-PPYMR-INWKSSDPMDGLDGLDGLLLRI---VARKMNFTLKLIPNEPN 263
            |..:.|..|.::|..| |||:. :|:..:...|...| .|:::.|   :.:::|.|.:::|    
 Worm    56 LSEMKGRTLKMVVPAIEPPYVNYVNFSDAAVTDKGYG-PGVVMEILKEIGKRLNLTYEILP---- 115

  Fly   264 GLIGGS--SFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVLQARGGY 326
             .:|.:  .::||::|||:..|.....::..|.|....:||...:.|.|:......|::::...|
 Worm   116 -ALGSTWGEYLNGSWTGAFGQLVRGEVDLLAGGAIMEYDRSVIADLTYPFQFEPTGIMIRSPEKY 179

  Fly   327 SIYEVMLFPFEKYTW---------LLLSTILGL--------------------HWIVGS---RWR 359
            . .:.:|...|.::|         :|:|.::.|                    .|:..|   :..
 Worm   180 E-DDTLLIVTEPFSWEVWVITAAVILISGVIFLVMTNIIRKVYEEMTVTPFESIWVFFSIFVQQG 243

  Fly   360 MPSP--------ILAGWMLWIFVIRASYEASVFNFIQNSPVKPSPRTLDQAL----SGGFRFITD 412
            :|..        ::|.|.|....:.|::..|:.............:.:||.:    .|.|..:.|
 Worm   244 LPEQPRSWSCRVLVALWWLASITLSATFTGSLVALFAVDKTNVPFQNIDQLVRLVKQGKFEIVMD 308

  Fly   413 HASYRMT-----LKIPSFQ 426
            ..|:..|     .|:|.::
 Worm   309 ENSFTRTEMIARSKLPVYR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
glr-8NP_001368711.1 PBP2_iGluR_ligand_binding 62..424 CDD:270219 52/273 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.