DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and glr-3

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_492017.3 Gene:glr-3 / 172449 WormBaseID:WBGene00001614 Length:836 Species:Caenorhabditis elegans


Alignment Length:379 Identity:73/379 - (19%)
Similarity:123/379 - (32%) Gaps:95/379 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WDVFPRRLKN--------------LHGCPLSVIVWDIPPYMRINWKSSDPMDG--LDGLDGLLLR 245
            |....||:.:              |.|..|.:.|:...|::.|.  |:...:|  :|     ||.
 Worm   374 WSSRTRRIASSEAVVIANSSEKLTLEGKHLKISVYLEAPFVMIT--SNGSYEGYCID-----LLH 431

  Fly   246 IVARKMNFTLKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSP 310
            .:|..:.||..:.....|..  ||...||.::|....|:...|::.:.....:..||..::.|.|
 Worm   432 KIANILKFTYTIQKVRDNAY--GSKESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVP 494

  Fly   311 YSQMSY-IIVLQARGGYSIYEVMLFPFEKYTWLLLSTILGLHWIVGSRWRMPSPILAGWMLWIFV 374
            |..:.. |:..:.|...|.:...:.|.....|::               ...|..:....:||..
 Worm   495 YMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIM---------------TFASYFVVSVAIWIIA 544

  Fly   375 IRASYEASVFNFIQ---NSPVKPSPR----------TLDQALSGGFRFITDHASYRMTLKIPSFQ 426
            ..:.||    .|.:   |...||...          |:...:..|.......||.|:...|..|.
 Worm   545 KISPYE----QFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFF 605

  Fly   427 GKTLISAGQPVDVFDALLKAPWKTGAFTSRAFLADHLVRHRKHRNQLVILAEKIVDNMLCMYFPH 491
            ...|||:      :.|.|.|...|....:....||.|....|.:...:               ..
 Worm   606 ALILISS------YTANLAAVLTTRRMETPIENADDLAAQTKIKYGTL---------------GR 649

  Fly   492 GSYFAWEINKLLFNMRSFGIFQHHSQILAWDNLPTTTDTDTPGKRIHSSTESVA 545
            ||..::      ||......::...|::          :.:||..:.||.|.:|
 Worm   650 GSTMSF------FNESKIETYERMWQLM----------SSSPGLFVQSSKEGIA 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
glr-3NP_492017.3 PBP1_iGluR_non_NMDA-like 21..385 CDD:380591 3/10 (30%)
Periplasmic_Binding_Protein_Type_2 401..761 CDD:419667 68/352 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.