DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Grin2d

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_036008580.1 Gene:Grin2d / 14814 MGIID:95823 Length:1345 Species:Mus musculus


Alignment Length:410 Identity:73/410 - (17%)
Similarity:134/410 - (32%) Gaps:177/410 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LLRIVARKMNFT--LKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCAACTPERSTFL 305
            :|:.:|..:.|:  |.|:.|..:|     ..::|.:.|....:..:||::.||......|||..:
Mouse   499 ILKRLAHTIGFSYDLYLVTNGKHG-----KKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIV 558

  Fly   306 EATSPYSQMSY-IIVLQARGGYSIYEVMLF----------PFEKYTWLLL----STILGLHWIV- 354
            :.:.|:.:... ::|.::.|..|....:.|          |:....|:::    .|::.:...: 
Mouse   559 DFSVPFVETGISVMVARSNGTVSPSAFLAFAWLMPPMSPEPYSPAVWVMMFVMCLTVVAVTVFIF 623

  Fly   355 -------------------GSRWRMPSPILAGWMLWIFVIR------------------------ 376
                               ||.:.:...|   |:||..|..                        
Mouse   624 EYLSPVGYNRSLATGKRPGGSTFTIGKSI---WLLWALVFNNSVPVENPRGTTSKIMVLVWAFFA 685

  Fly   377 ----ASYEASVFNFI----------------------QNSPVK----PS---------------- 395
                |||.|::..|:                      |..|:|    |:                
Mouse   686 VIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIRSNYPDMHS 750

  Fly   396 -------PR---TLDQALSGGF-RFITDHA--SYRMTLK------IPSFQGKTLISAG------- 434
                   ||   .|.|..:|.. .||.|.|  :| |..|      :....||...:.|       
Mouse   751 YMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNY-MARKDEGCKLVTIGSGKVFATTGYGIALHK 814

  Fly   435 -----QPVDVFDALLKAPWKTGAFTSRAFLADHLVRHRK--------HRNQLVILAEKI-VDNML 485
                 :|:|:  |||:            ||.|..:...:        |.:::.:::.|: :|||.
Mouse   815 GSRWKRPIDL--ALLQ------------FLGDDEIEMLERLWLSGICHNDKIEVMSSKLDIDNMA 865

  Fly   486 CMYF----PHG---SYFAWE 498
            .:::    ..|   ..||||
Mouse   866 GVFYMLLVAMGLSLLVFAWE 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
Grin2dXP_036008580.1 Periplasmic_Binding_Protein_type1 <156..415 CDD:415822
PBP2_iGluR_NMDA_Nr2 432..849 CDD:270436 63/372 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.