DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and Grin2c

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_017169765.1 Gene:Grin2c / 14813 MGIID:95822 Length:1307 Species:Mus musculus


Alignment Length:337 Identity:64/337 - (18%)
Similarity:112/337 - (33%) Gaps:110/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 HGVQAFNVRPYTPTSCSSLEPVEIDIK----------------------DGDLWDVFPRRLKNLH 208
            ||| .:...|..|...:||:|| :|.:                      .|.:.:..|.|.::.|
Mouse   439 HGV-LYMKYPVWPRYSTSLQPV-VDSRHLTVATLEERPFVIVESPDPGTGGCVPNTVPCRRQSNH 501

  Fly   209 GCPLSVIVWDIPPYMRINWKSSDPMDGLDGLDGLLLRIVAR-----KMNFTLKLIPNEPNGLIGG 268
                :....||.||.::..|            |..:.|:.:     |.::.|.|:.|..:|    
Mouse   502 ----TFSSGDITPYTKLCCK------------GFCIDILKKLAKVVKFSYDLYLVTNGKHG---- 546

  Fly   269 SSFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVLQARGGYSIYEVML 333
             ..:.|.:.|....:..:||::.||......|||..::.:.|:.:....:::....|.......|
Mouse   547 -KRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVARSNGTVSPSAFL 610

  Fly   334 FPFEKYTWLLLSTILGLHWIVGSRWRMPSPILAGWMLWIFVIRASYEA-SVFNFIQNSPVKPSPR 397
            .|:....|:::                            ||:..:..| :||.|...|||..:..
Mouse   611 EPYSPAVWVMM----------------------------FVMCLTVVAITVFMFEYFSPVSYNQN 647

  Fly   398 TLDQALSGGFRFITDHASYRMTLKIPSFQ-GKTL-----------ISAGQPVDVFDALLKAPWKT 450
            ......|||                |||. ||::           :....|......::...|  
Mouse   648 LTKGKKSGG----------------PSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVW-- 694

  Fly   451 GAFTSRAFLADH 462
             ||.:..|||.:
Mouse   695 -AFFAVIFLASY 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
Grin2cXP_017169765.1 PBP1_iGluR_NMDA_NR2 90..446 CDD:380601 3/7 (43%)
PBP2_iGluR_NMDA_Nr2 462..868 CDD:270436 54/312 (17%)
NMDAR2_C 905..>980 CDD:371139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.