DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and LOC100334689

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_017206939.1 Gene:LOC100334689 / 100334689 -ID:- Length:991 Species:Danio rerio


Alignment Length:243 Identity:54/243 - (22%)
Similarity:92/243 - (37%) Gaps:70/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SVIVWDI--PPYMRINWKSSDPMDGLDGLDGL---LLRIVARKMNFT--LKLIPNEPNGLIGGSS 270
            |:::..|  .||:.:. ||...:.|.|..:|.   ||:.:|..:.|:  :.|:|:      |...
Zfish   428 SLVITTILEEPYVMLK-KSDKALVGNDRFEGFCIDLLKELASILGFSYEIHLVPD------GKYG 485

  Fly   271 FMN--GTFTGAYKMLRERRANITIGCAACTPER--------------------------STFLEA 307
            |.:  |.:.|..:.|.|.||::.:.....|..|                          |.|...
Zfish   486 FQDDKGQWNGMIRELMEHRADLAVAPLTITFMREKAIDFSKPFLNTGISILYRKPNSTNSGFFSF 550

  Fly   308 TSPYSQMSYIIVLQARGGYSIYEVMLFPFEKYTWLLLS-------------TILGLHWI-VGSRW 358
            .:|.:...::.:|.|..|.|....::..|..|.|....             |:|...|. |||..
Zfish   551 LNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVGSLM 615

  Fly   359 R-----MPSPI---LAGWMLWIF--VIRASYEASVFNFI----QNSPV 392
            :     ||..:   :.|.:.|.|  :|.:||.|::..|:    .:|||
Zfish   616 QQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPV 663



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.