DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7d and si:dkey-183j2.10

DIOPT Version :9

Sequence 1:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_001923977.1 Gene:si:dkey-183j2.10 / 100151589 ZFINID:ZDB-GENE-130530-729 Length:465 Species:Danio rerio


Alignment Length:199 Identity:41/199 - (20%)
Similarity:67/199 - (33%) Gaps:60/199 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGSSF----MNGTFTGAYKMLRERRANITIGCAA 296
            |:|....||..:|:|:.|..|:      .|:...|:    .||.:.|....:....|::.:....
Zfish    49 LEGYCMDLLTELAKKLGFKYKV------HLVKDGSYGRQDENGNWNGMIGEVVRGEADLAVAPLT 107

  Fly   297 CTPERSTFLEATSPYSQMSYIIVLQ-----ARGGYSIYEVMLFPFEKYTW--LLLS--------- 345
            .|..|...:..|.||.|....|:|:     ...|:..:   |.||...||  :|::         
Zfish   108 LTAAREKAVGMTKPYMQTGISILLRKDIVSEEAGFFDF---LSPFSGETWFGILIAYFVTAVCIC 169

  Fly   346 --------------------TILGLHWIVGSRWRM----PSP-------ILAGWMLWIFVIRASY 379
                                |:|...|.......:    |.|       |...|.|:..|:.|.|
Zfish   170 IVGRLSPCEWSQPETEPNHFTLLHSLWYTAGALSLQGAGPHPKAVSGRVISCTWWLFAVVLLACY 234

  Fly   380 EASV 383
            .:|:
Zfish   235 FSSL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7dNP_001138175.1 None
si:dkey-183j2.10XP_001923977.1 PBP2_iGluR_non_NMDA_like 28..381 CDD:270403 41/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.