DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and grik5

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001315085.1 Gene:grik5 / 798791 ZFINID:ZDB-GENE-070821-6 Length:1067 Species:Danio rerio


Alignment Length:468 Identity:84/468 - (17%)
Similarity:157/468 - (33%) Gaps:99/468 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 IERRLDNSTVIFEKRLENLHGYEVPIALGGSSPRLIVYRDLEGKLIFSGPVGNFMKSFEQ----R 220
            :...|.|.::|....|||      |..:     |.|.|::.||...:.|...:.::....    .
Zfish   421 VSETLANKSLIITTILEN------PYVM-----RKINYQEFEGNEQYEGFCVDMLRELSDILKFT 474

  Fly   221 YNCRLVQ------PYPFDESAISPARDLIASVQNGSVQIALGAI---YPQVPYTGYSYPIELMSW 276
            |..:||.      |.| :.|......:||    |....:|:.|.   ..:.....:|.|...:..
Zfish   475 YRIKLVDDGLYGAPEP-NGSWTGMVGELI----NRKADLAVAAFTITSEREKVIDFSKPFMTLGI 534

  Fly   277 CLMMPVP-EEVPHSQLYSMVFSPMAFGITIVAMVLISLTLSMALRLHGYRVSFSEYFLHDSCLR- 339
            .::..|. ...|....:...|||..:...::|.:.:|..|.::.||..|     |::....||| 
Zfish   535 SILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPY-----EWYNPHPCLRE 594

  Fly   340 -------------------GVLSQSFYEVLRAPALIKAMYLVICLLG------LLITSWYNSYFS 379
                               |...|...|::  |..:...    |:.|      |:|.|.|.:..:
Zfish   595 RRDLLENQYTLGNSLWFPVGGFMQQGSEIM--PRALSTR----CVSGVWWAFTLIIISSYTANLA 653

  Fly   380 TFVTSAPRFPQLTSYESIR-HSNIKIVIWKPEYEMLLFFSENMEKYSSIFQLQEDYKEFLHLRDS 443
            .|:|.......:.|.:.:. .:||:.........|..|.:...:.|..::......:..:.::.:
Zfish   654 AFLTVQRMEVPIESPDDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKST 718

  Fly   444 -------FDTRYGYMMPMEKWSLMKEQQRVFSSPLFSLQDDLCVFHTVPIVFPMVKNSIFKEPFD 501
                   .:::|.:::.    |.|.|..|..:..|..:..   :..|......|...|.|::...
Zfish   719 EEGIARVVNSKYAFLLE----STMNEYHRSLNCNLTQIGG---LLDTKGYGIGMPLGSPFRDELS 776

  Fly   502 RLILDVTATGLLS----RWRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGDLIQIWRFVGWMLGL 562
            ..:|.:.....|.    ||.:        .|:...|:....|......:|.:     ||..:.||
Zfish   777 LAVLQLQENNRLEILKRRWWE--------GGKCPKEEDHRAKGLGMENIGGI-----FVVLICGL 828

  Fly   563 ATIVFLLELICFW 575
            ...||:..:...|
Zfish   829 IIAVFVAVMEFVW 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
grik5NP_001315085.1 PBP1_iGluR_Kainate_KA1_2 38..412 CDD:107389
ANF_receptor 55..392 CDD:279440
Periplasmic_Binding_Protein_Type_1 <313..383 CDD:299141
Periplasmic_Binding_Protein_Type_2 427..797 CDD:304360 72/403 (18%)
Lig_chan 558..828 CDD:278489 48/300 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.