DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and grid1a

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_021323097.1 Gene:grid1a / 793756 ZFINID:ZDB-GENE-120411-28 Length:1044 Species:Danio rerio


Alignment Length:422 Identity:78/422 - (18%)
Similarity:147/422 - (34%) Gaps:162/422 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 NFMKSFEQRYNCRLVQP-YPFDESAISPARDL-----IASVQN------GSVQIALGAIYPQVPY 264
            :.::|....::.:|::| .||  .|:..|.:|     :|.|.:      .::|....|::  :|:
Zfish    53 DILQSERITHSIKLIEPNNPF--QAVQEACELMNQGILALVSSTGCAAANALQSLTDAMH--IPH 113

  Fly   265 -----TGYSYPIELMSWCLMMPVPEEVPHSQLYSMVFSPMAFGITIVAMVLISLTLSMALRLHGY 324
                 .|...|   .:.|.:.|.|:    .:.|::...|.      |.:..:.:||...||.|.:
Zfish   114 LFIQRNGDGTP---RAECQLNPSPD----GERYTLAARPP------VRLNDVMITLVSELRWHKF 165

  Fly   325 RVSF-SEYFLHDSCLRGVLSQSFYEVLRAPALIKAMYLVICL--LGLLITSWYNSYFSTFVTSAP 386
            .|.: |||.:..  |||.|.|:           ..|.|.:.|  :...:|..:::.|||.     
Zfish   166 IVFYDSEYDVRG--LRGFLDQA-----------SRMGLDVSLQQVDRNVTKVFSTLFSTM----- 212

  Fly   387 RFPQLTSY-ESIRHSNIKIVIWKPEYEMLLFFSENMEK----------YSSIFQLQEDYKEFLH- 439
            |..:|..| :::|.:   |::..|.... :|..:.:|.          |::......:..|.:| 
Zfish   213 RMEELNRYRDTLRRA---ILLLSPRTAQ-VFIHQAVETNLASKDSHWVYANEEVSDTEIMELVHS 273

  Fly   440 -------LRDSF----------------------DTRYGYMMPMEKWSLMKEQQRVFSSPLFSLQ 475
                   :|..|                      |.:.||:..:|..||.     ::.|.|    
Zfish   274 ALGRMTVIRQIFPLWRDTNIRCMRNNHRISSLLCDPQEGYLQSLEVSSLY-----LYDSVL---- 329

  Fly   476 DDLCVFHTVPIVFPMVKNSIFKEPFDRLILDVTATGLLSRWRDM-----------------SFTE 523
                          |:.|:.:::..||            :|..|                 |..:
Zfish   330 --------------MLANAFYRKLEDR------------KWHSMASLNCMRKSTKPWNGGWSMLD 368

  Fly   524 MIKAGQL----GLEDRGHPKEFRAMKVGDLIQ 551
            .|:.|::    ||.|      ||:......:|
Zfish   369 TIQKGRISGLTGLMD------FRSNGANSHVQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
grid1aXP_021323097.1 Periplasmic_Binding_Protein_Type_1 25..424 CDD:324556 78/422 (18%)
PBP2_iGluR_delta_1 437..809 CDD:270448
DNA_pol3_gamma3 <915..1044 CDD:331207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.