DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and grik1b

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_690040.5 Gene:grik1b / 561540 ZFINID:ZDB-GENE-070821-1 Length:906 Species:Danio rerio


Alignment Length:206 Identity:47/206 - (22%)
Similarity:83/206 - (40%) Gaps:50/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 LITSWYNSYFSTFVTSAPRFPQLTSY----ESIRHSNIKIV------IWKPEYEMLLFFSENMEK 423
            ::|.:|:.:|:|          |..|    |..|:|.:.:.      |..|:...:      :||
Zfish   275 MMTEYYHFFFTT----------LDLYSLDLEPFRYSGVNMTGFRLLNIDNPQVASV------VEK 323

  Fly   424 YSSIFQLQEDYKEFLHLRDSFDTRYGYMMPMEKWSLMKEQQRVFSSPLFSLQDDLCVFHTVPIVF 488
            : |:.:||...|....|:|...|....:|....:.:....||.....:.|||   |..|. |..|
Zfish   324 W-SMERLQAPPKPETGLQDGMMTTEAALMYDAVYMVAAASQRASQITVSSLQ---CHRHK-PWRF 383

  Fly   489 PMVKNSIFKEP-----FDRLILDVTATGLLSRWRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGD 548
            .....|:|||.     ..::|::.| .||.   :|... ::|...:.|||        :.::.|.
Zfish   384 GSRFISMFKEAQWNGLTGQIIINKT-DGLR---KDFDL-DIISLKEDGLE--------KPLESGR 435

  Fly   549 LIQIWRFVG-W 558
            ..::|:.:| |
Zfish   436 FNKVWKKIGVW 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
grik1bXP_690040.5 Periplasmic_Binding_Protein_Type_1 62..455 CDD:299141 47/206 (23%)
ANF_receptor 80..423 CDD:279440 40/173 (23%)
Periplasmic_Binding_Protein_Type_2 471..840 CDD:304360
Lig_chan 602..871 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.