Sequence 1: | NP_001138099.1 | Gene: | Ir94d / 7354412 | FlyBaseID: | FBgn0259193 | Length: | 593 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_690040.5 | Gene: | grik1b / 561540 | ZFINID: | ZDB-GENE-070821-1 | Length: | 906 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 47/206 - (22%) |
---|---|---|---|
Similarity: | 83/206 - (40%) | Gaps: | 50/206 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 369 LITSWYNSYFSTFVTSAPRFPQLTSY----ESIRHSNIKIV------IWKPEYEMLLFFSENMEK 423
Fly 424 YSSIFQLQEDYKEFLHLRDSFDTRYGYMMPMEKWSLMKEQQRVFSSPLFSLQDDLCVFHTVPIVF 488
Fly 489 PMVKNSIFKEP-----FDRLILDVTATGLLSRWRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGD 548
Fly 549 LIQIWRFVG-W 558 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir94d | NP_001138099.1 | None | |||
grik1b | XP_690040.5 | Periplasmic_Binding_Protein_Type_1 | 62..455 | CDD:299141 | 47/206 (23%) |
ANF_receptor | 80..423 | CDD:279440 | 40/173 (23%) | ||
Periplasmic_Binding_Protein_Type_2 | 471..840 | CDD:304360 | |||
Lig_chan | 602..871 | CDD:278489 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170591606 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |