DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and grik2

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_021322472.1 Gene:grik2 / 556013 ZFINID:ZDB-GENE-080414-1 Length:908 Species:Danio rerio


Alignment Length:556 Identity:93/556 - (16%)
Similarity:173/556 - (31%) Gaps:222/556 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 WHHQLLKVVAIAQDFMESLIVYSYNPFPVLQFIERRLDNSTVIFEKRLENLHGYEVPIALGGSSP 192
            |.||:       .|..:|..|   |.:|....:.|.:          |:.:|.::....      
Zfish   134 WKHQV-------SDNRDSFYV---NLYPDFSSLSRAI----------LDLVHFFKWKTV------ 172

  Fly   193 RLIVYRDLEGKL----IFSGPVGNFMKSFEQRYNCRL-VQPYPFDESAISPARDLIASVQNGSVQ 252
             .:||.|..|.:    :...|         .|||.|| ::..|.|   ...|:.|:..::.|.  
Zfish   173 -TVVYDDSTGLIRLQELIKAP---------SRYNIRLKIRQLPAD---TKDAKPLLKEMKRGK-- 222

  Fly   253 IALGAIYPQVPYTGYSYPIELMSWCLMMPVPEEVPH-----SQLYSMVFSPMAFGITIVAMVLIS 312
             ....|:.    .|:.....::...|.|.:..|..|     ..|:::...|..:.          
Zfish   223 -EFHVIFD----CGHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYS---------- 272

  Fly   313 LTLSMALRLHGYRVSFSEYFLHDSCLRGVLSQSFYEVLRAP-----ALIKA--------MYLVIC 364
                 .:.:.|:|:..:|    :|.:..::.:...|.|:||     .|:..        ||..:.
Zfish   273 -----GVNMTGFRILNTE----NSQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVH 328

  Fly   365 LLGLLITS----------------W-YNSYFSTFVTSAPRFPQLTSYESIRHSN----------- 401
            ::.:.:..                | :.:.|.|.:..| .:..||...:...:|           
Zfish   329 VVAVAVQQSPQITVSSLQCNRHKPWRFGNRFMTLIKEA-HWDGLTGRINFNRTNGLRTDFDLDVI 392

  Fly   402 -------IKIVIWKPEYEMLLFFSENME-KYSSIFQ------------LQEDYKEF------LHL 440
                   .||..|.|...  |..:||.: |.:::..            |:|.|..|      |:.
Zfish   393 SLKEEGLEKIGTWDPASG--LNMTENQKGKTANVTDSLSNRSLVVSTILEEPYVMFKKSDKPLYG 455

  Fly   441 RDSFDTRYGYMMPMEKWSLMKE---------QQRVFSSPLFSLQD------------------DL 478
            .|.|:   ||.:     .|::|         :.|:.....:..||                  ||
Zfish   456 NDRFE---GYCV-----DLLRELAAILGFGYELRLVEDGRYGAQDESSGQWNGMVRELMDHKADL 512

  Fly   479 CVFHTVPIVFPMVKNSI--FKEPFDRLILDV-------TATGLLSRWRDMSFTEMIKAGQLGLED 534
            .|   .|:....|:..:  |.:||..|.:.:       |..|:.|....:|              
Zfish   513 AV---APLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLS-------------- 560

  Fly   535 RGHPKEFRAMKVGDLIQIWRFVGW-MLGLATIVFLL 569
               |            .||.::.. .||::.::|::
Zfish   561 ---P------------DIWMYILLAYLGVSCVLFVI 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
grik2XP_021322472.1 PBP1_iGluR_Kainate 37..414 CDD:380605 57/347 (16%)
Periplasmic_Binding_Protein_Type_2 430..800 CDD:419667 33/192 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.