DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and Ir93a

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster


Alignment Length:489 Identity:91/489 - (18%)
Similarity:178/489 - (36%) Gaps:97/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PVLQFIERRLDNSTVIFEKRLENLHGYEVPIALGGSSPRLIVYRDLEGKLI-FSGPVGNFMKSFE 218
            |||.|:.:.|....:  |....|:   .:.|....:.|..|:.::..|.:: ..|.|...:|...
  Fly   412 PVLGFVCQELAFPHI--EHHFRNI---TMDILTVHNPPWQILTKNSNGVIVEHKGIVMEIVKELS 471

  Fly   219 QRYNCRLVQPYPFDESAISPARDLIASVQNGSVQIAL-GAIYPQVPYT----------------- 265
            :..|.    .|...|::.....|.:::...|:....| |::..::||.                 
  Fly   472 RALNF----SYYLHEASAWKEEDSLSTSAGGNESDELVGSMTFRIPYRVVEMVQGNQFFIAAVAA 532

  Fly   266 ----------GYSYPIELMSWCLMMPVPEEVPHSQLYSMVFSPMAFGITIVAMVLISLTLSMALR 320
                      .|:.||.:..:..:...|:||....|::..|:...:...:..::|.:.||....|
  Fly   533 TVEDPDQKPFNYTQPISVQKYSFITRKPDEVSRIYLFTAPFTVETWFCLMGIILLTAPTLYAINR 597

  Fly   321 LHGYR----VSFSEYFLHDSC---LRGVLSQS---FYEVLRAPALIKAMYLVICLLGLLITSWYN 375
            |...:    |..|..   .||   :.|.|.|.   :.....:..|:...:.::.:  :|:|::..
  Fly   598 LAPLKEMRIVGLSTV---KSCFWYIFGALLQQGGMYLPTADSGRLVVGFWWIVVI--VLVTTYCG 657

  Fly   376 SY--FSTFVTSAPRFPQLTSYESIRHSNIKIVIWKPEYEML--LFFSENMEKYSSIFQLQEDYKE 436
            :.  |.||....|....|...|.  |.:|      .:|.:.  .||...::..:     :||:|.
  Fly   658 NLVAFLTFPKFQPGVDYLNQLED--HKDI------VQYGLRNGTFFERYVQSTT-----REDFKH 709

  Fly   437 FLHL---------RDSFDTRYGYMMPMEKW--SLMKEQQRVFSSPL---FSLQDDLCVFHTVPIV 487
            :|..         .|....:.|..:.:: |  :|....||.|....   |:|..:..|...:.::
  Fly   710 YLERAKIYGSAQEEDIEAVKRGERINID-WRINLQLIVQRHFEREKECHFALGRESFVDEQIAMI 773

  Fly   488 FPMVKNSIFKEPFDRLILDVTATGLLSRWRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGDLIQI 552
            .|  ..|.:....:|.|..:...|.:.||..|:   :..||:...:..........:.:.|:...
  Fly   774 VP--AQSAYLHLVNRHIKSMFRMGFIERWHQMN---LPSAGKCNGKSAQRQVTNHKVNMDDMQGC 833

  Fly   553 WRFVGWMLGLATIVFLLELIC--FWRHKMWQNMK 584
              |:..:||. |:..|  ::|  ||..:...:.|
  Fly   834 --FLVLLLGF-TLALL--IVCGEFWYRRFRASRK 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 51/287 (18%)
Lig_chan 576..836 CDD:306551 52/285 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.