DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and Ir87a

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:417 Identity:83/417 - (19%)
Similarity:168/417 - (40%) Gaps:72/417 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GKLIFSGPVGNFMKSFEQRYNCRLVQPYPFDESAISPARDLIASVQNGSVQIALGAI-----YPQ 261
            |||..||.....:::..:|.:..:..     :...|....|...:.:|.:::.:|.|     ..|
  Fly   405 GKLKLSGIEYEMVQTIAERLHVSIEM-----QGENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQ 464

  Fly   262 VPYTGYSYPIELMSWCLMMPVPEEVPHSQLYSMV--FSPMAFGITIVAMVLISLTLSMALRLHGY 324
            ...:...|..:.::||    |.........::.|  |:..|..:..:.:|..||.:.:|.|:.|:
  Fly   465 FVSSSIPYHQDELTWC----VARAKRRHGFFNFVATFNADAGFLIGIFVVTCSLVVWLAQRVSGF 525

  Fly   325 RV-SFSEYFLHDSCLR--GVLSQSFYEVLRAPALIKAMYLVICLLGLLITSWYNSYFSTFVTSAP 386
            :: :.:.||  .:|||  |:|..........|..::.::.:..|:|...::.|.|:..:.:|:..
  Fly   526 QLRNLNGYF--PTCLRVLGILLNQAIPAQDFPITLRQLFALSFLMGFFFSNTYQSFLISTLTTPR 588

  Fly   387 RFPQLTSYESIRHSNIKIVIWKPEYEMLLFFSENMEKYSSIFQLQEDYKEFLHLRDSFDTRYGYM 451
            ...|:.:.:.| :||...|:...|:               :..|.:|.:.|.::|:.|...|..:
  Fly   589 SSYQIHTLQEI-YSNKMTVMGTSEH---------------VRHLNKDGEIFKYIREKFQMCYNLV 637

  Fly   452 ------MPMEKWSLMKEQQRVFSSP--------LFSLQDDLCVFHTVPIVFPMVKNSIFKEPFDR 502
                  ...|..::...:|..|.:|        .|..::.|.|: .|.::.|  |........:.
  Fly   638 DCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESLYVY-LVTMLLP--KKYHLLHQINP 699

  Fly   503 LILDVTATGLLSRW-RDMSFTEMIKAGQLGLEDRGHPKE--FRAMKVGDLIQIWRFVGWMLGLAT 564
            :|..:..:|.:.:| ||:....||.      |:....:|  |:|:..........|.|.:|.:|:
  Fly   700 VIQHIIESGHMQKWARDLDMRRMIH------EEITRVREDPFKALTFDQFRGAIAFSGGLLLVAS 758

  Fly   565 IVFLLELICFWRHKMWQNMKYMFCRNK 591
            .||..|| |:        :||::...|
  Fly   759 CVFAFEL-CY--------VKYVYRTEK 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 10/71 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.