DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and Nmdar1

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_730940.1 Gene:Nmdar1 / 40665 FlyBaseID:FBgn0010399 Length:997 Species:Drosophila melanogaster


Alignment Length:282 Identity:64/282 - (22%)
Similarity:107/282 - (37%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSPGGDSFYHSLIHHLN--RELKIEYVLLLGNFDTTWLDILWQLPVSVLQIKEHSRETYSLLENP 76
            |||.| .|.|.::.:..  ..|:.|:..|:|.......|::    |:.|.|.. .|..|.....|
  Fly   488 LSPDG-QFGHYILRNNTGAMTLRKEWTGLIGELVNERADMI----VAPLTINP-ERAEYIEFSKP 546

  Fly    77 SHNVLTIAFVNDSPEDILEILYRNLRMLNTQPVLLVIRKSTIRVNSLLEW---CWHHQLLKVVAI 138
                               ..|:.:.:|..:|    .|.||: |:.|..:   .|...::.|..:
  Fly   547 -------------------FKYQGITILEKKP----SRSSTL-VSFLQPFSNTLWILVMVSVHVV 587

  Fly   139 AQDFMESLIVYSYNPF-PVLQFIERRLDNSTVIFEKRLENLH-------GYEVPIALGGSSPRLI 195
            |      |::|..:.| |..:|   :|.:|....||.| ||.       |..:...:|..:||..
  Fly   588 A------LVLYLLDRFSPFGRF---KLSHSDSNEEKAL-NLSSAVWFAWGVLLNSGIGEGTPRSF 642

  Fly   196 VYRDLEGKLIFSGPVGNFMKSFEQRYNCRLVQPYPFDE-SAISPAR------DL-IASVQNGSV- 251
            ..|.|  .::::|.....:.|:.......||...|..: |.|:.||      :| .|:|:..|| 
  Fly   643 SARVL--GMVWAGFAMIIVASYTANLAAFLVLERPKTKLSGINDARLRNTMENLTCATVKGSSVD 705

  Fly   252 -----QIALGAIYPQVPYTGYS 268
                 |:.|..:|..:....|:
  Fly   706 MYFRRQVELSNMYRTMEANNYA 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
Nmdar1NP_730940.1 PBP1_iGluR_NMDA_NR1 12..405 CDD:107374
ANF_receptor 58..371 CDD:279440
PBP2_iGluR_NMDA_Nr1 417..818 CDD:270437 64/282 (23%)
HisJ 451..>558 CDD:223904 19/94 (20%)
Periplasmic_Binding_Protein_Type_2 <516..651 CDD:304360 37/175 (21%)
Lig_chan 575..838 CDD:278489 39/165 (24%)
CaM_bdg_C0 854..882 CDD:287524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.