DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and gria1b

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_991293.1 Gene:gria1b / 403044 ZFINID:ZDB-GENE-020125-2 Length:917 Species:Danio rerio


Alignment Length:256 Identity:44/256 - (17%)
Similarity:78/256 - (30%) Gaps:98/256 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LLITSWYNSYFSTFVTSAPRFPQLTSYESI--------------------RHSNIKIV--IW--- 407
            |:|.|.|.:..:.|:|.......:.|.|.:                    |.|.|.:.  :|   
Zfish   649 LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFRRSKIAVFEKMWSYM 713

  Fly   408 ---------KPEYEMLLFFSENMEKYSSIFQLQEDYKEFLHLRDSFDTR----------YGYMMP 453
                     |...|.::...::..||:  :.|:....|::..|...||.          ||...|
Zfish   714 KSAEPTVFVKTTDEGVVRVRKSKGKYA--YLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATP 776

  Fly   454 MEKWSLMKEQQRVFSSPLFSLQDDLCVFHTVPIVFPMVKNSIFKEPFDRLILDVTATGLLSR--- 515
                                                  |.|..:.|.:..:|.:...|||.:   
Zfish   777 --------------------------------------KGSALRNPVNLAVLKLNEQGLLDKLKN 803

  Fly   516 --WRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGDLIQIWRFVGWMLGLATIVFLLELICF 574
              |.|        .|:.|........:..|:.:.::..::..:...||||.:|.|:| .|:
Zfish   804 KWWYD--------KGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALVE-FCY 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
gria1bNP_991293.1 PBP1_iGluR_AMPA_GluR1 26..387 CDD:107385
ANF_receptor 41..368 CDD:279440
PBP2_iGluR_AMPA_GluR1 404..812 CDD:270447 34/210 (16%)
Lig_chan 536..842 CDD:278489 36/240 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.