DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and GluRIA

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster


Alignment Length:143 Identity:30/143 - (20%)
Similarity:54/143 - (37%) Gaps:30/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 ALRLHGYRVSFSEYFLHDSCLRGVLSQSFYEVLRAPALIKAMYLVIC---------LLGLL---- 369
            |:..|...||...:.|          |::.:|:......|...| ||         :||.:    
  Fly    60 AMLNHNLNVSSRRFEL----------QAYVDVINTADAFKLSRL-ICNQFSRGVYSMLGAVSPDS 113

  Fly   370 ---ITSWYNSYFSTFVTSAPRFPQLTSYESIRHSNIKIVIWKPEYEMLLFFSENMEKYSSIFQLQ 431
               :.|:.|::...|||  |.||:.....|....:..|.: :|:|...:..:.....:.||..|.
  Fly   114 FDTLHSYSNTFQMPFVT--PWFPEKVLAPSSGLLDFAISM-RPDYHQAIIDTIQYYGWQSIIYLY 175

  Fly   432 EDYKEFLHLRDSF 444
            :.:...|.|:..:
  Fly   176 DSHDGLLRLQQIY 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375 30/143 (21%)
ANF_receptor 53..434 CDD:279440 30/143 (21%)
PBP2_iGluR_AMPA 477..879 CDD:270433
Lig_chan 612..907 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.