DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and gria3b

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_938174.1 Gene:gria3b / 368416 ZFINID:ZDB-GENE-030616-53 Length:883 Species:Danio rerio


Alignment Length:426 Identity:73/426 - (17%)
Similarity:129/426 - (30%) Gaps:150/426 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 ARDLIASVQNGSV-QIALG----AIYP------QVPYTGYSYPIELMSWCLMMPVPEEVPHSQLY 292
            |||......||.| ::..|    |:.|      :.....:|.|...:...:|:..|::....   
Zfish   472 ARDPETKSWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPG--- 533

  Fly   293 SMVFS---PMAFGI---TIVAMVLISLTLSMALRLHGYRVSFSE----------------YFLHD 335
              |||   |:|:.|   .:.|.:.:|:.|.:..|...|.....|                :.:.:
Zfish   534 --VFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWQLDETDEVKDPQTPPDPPNDFGIFN 596

  Fly   336 SC--LRGVLSQSFYEVLRAPALIKAMYL--VICLLGLLITSWYNSYFSTFVTSAPRFPQLTSYES 396
            |.  ..|...|...::  :|..:....:  |.....|:|.|.|.:..:.|:|.......:.|.|.
Zfish   597 SLWFSLGAFMQQGCDI--SPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED 659

  Fly   397 I--------------------RHSNIKIVIWKPEYEMLLFFSENME------------------K 423
            :                    |.|.|.:      ||.:..:.::.|                  |
Zfish   660 LAKQTEIAYGTLDSGSTKEFFRRSKIAV------YEKMWSYMKSAEPSVFAKTTPDGVARVRKSK 718

  Fly   424 YSSIFQLQEDYKEFLHLRDSFDTR----------YGYMMPMEKWSLMKEQQRVFSSPLFSLQDDL 478
            ....|.|:....|::..|...||.          ||...|                         
Zfish   719 GKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATP------------------------- 758

  Fly   479 CVFHTVPIVFPMVKNSIFKEPFDRLILDVTATGLLSR-----WRDMSFTEMIKAGQLGLEDRGHP 538
                         |.|..:...:..:|.:...|||.:     |.|        .|:.|.......
Zfish   759 -------------KGSALRNAVNLAVLKLNEQGLLDKLKNKWWYD--------KGECGSGGGDSK 802

  Fly   539 KEFRAMKVGDLIQIWRFVGWMLGLATIVFLLELICF 574
            .:..|:.:.::..::..:...||||.:|.|:| .|:
Zfish   803 DKTSALSLSNVAGVFYILVGGLGLAMMVALIE-FCY 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
gria3bNP_938174.1 Periplasmic_Binding_Protein_Type_1 25..396 CDD:299141
ANF_receptor 36..379 CDD:279440
PBP2_iGluR_AMPA 412..794 CDD:270433 63/380 (17%)
Lig_chan 544..824 CDD:278489 47/333 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.