DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and GluRIIE

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001036733.1 Gene:GluRIIE / 318623 FlyBaseID:FBgn0051201 Length:897 Species:Drosophila melanogaster


Alignment Length:312 Identity:63/312 - (20%)
Similarity:89/312 - (28%) Gaps:161/312 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 ENLHGYE-------VPIALGGSSPRLIVYRDLEGKLIF-------SGPVGNFMKSFEQRYN---- 222
            ||..||:       |||.|      |......:..::|       :..||..:.|.::..|    
  Fly    25 ENFGGYDNYQSLESVPIGL------LTDQNTEQMNIVFDHAIDVANQEVGTSLTSLKEEVNYGDA 83

  Fly   223 -------CRLVQPYPFDESAISPARDLIASVQNGSVQIALGAIYPQVPYTGYSYPIELMSWCLMM 280
                   ||::      |:.|:                  |...|...:|.    :.|||.|..|
  Fly    84 YQSYGKLCRML------ETGIA------------------GVFGPSSRHTA----VHLMSICDAM 120

  Fly   281 PVPEEVPHSQLYSMVFSPMAFGITIVAMVLISLTLSMALRLHGYRVSFSEYFLHDSCLRGVLSQS 345
                ::||  :||.                      |:....|:.       ||..         
  Fly   121 ----DIPH--IYSY----------------------MSENAEGFN-------LHPH--------- 141

  Fly   346 FYEVLRAPA-LIKAMYLVICLLGLLIT--SWYNSYFSTFVTSAPRFPQLTSYESIRHSNI----- 402
                   || |.||:|       .|||  :|....|              .|||..:.||     
  Fly   142 -------PADLAKALY-------SLITEFNWTRFIF--------------LYESAEYLNILNELT 178

  Fly   403 ------KIVIWKPEYEMLLFFSENMEKYSSIFQLQEDYKEFL-HLRDSFDTR 447
                  ..||....|:|               ||..:||:.| .:|.|.|.|
  Fly   179 TMLGKSGTVITVLRYDM---------------QLNGNYKQVLRRVRKSVDNR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
GluRIIENP_001036733.1 PBP1_iGluR_Kainate 42..396 CDD:107377 56/295 (19%)
ANF_receptor 51..382 CDD:279440 54/280 (19%)
PBP2_iGluR_Kainate 419..790 CDD:270432
Lig_chan 551..824 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.