DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and Nmdar2

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001014714.1 Gene:Nmdar2 / 31107 FlyBaseID:FBgn0053513 Length:1083 Species:Drosophila melanogaster


Alignment Length:393 Identity:78/393 - (19%)
Similarity:130/393 - (33%) Gaps:125/393 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 PFDESAISPARDLIASVQNGSVQIALGAIYPQVPYTGYSYPIELMSWCLMMPVPEEVPHSQLYSM 294
            ||.|:.|:    ::.:.:.|.:.          | |.:..|.:..||.|:..|..:.....::..
  Fly   634 PFMETGIA----IVVAKRTGIIS----------P-TAFLEPFDTASWMLVGIVAIQAATFMIFLF 683

  Fly   295 VF-SPMAFGITIVAMVLISLTLSMALRLHG-----YRVS-FSEYFL----------HDSCLRGVL 342
            .: ||..:              .|.|.|..     ||.| |..|:|          |....||..
  Fly   684 EWLSPSGY--------------DMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFT 734

  Fly   343 SQSFYEVLRAPALIKAMYLVICLLGLLITSWYNSYFSTFVTSAPRFPQLTSYESIR------HSN 401
            |:....|.   ||...::|.|          |.:..:.|:.:...|.:.:.....|      |  
  Fly   735 SRFMTNVW---ALFAVVFLAI----------YTANLAAFMITREEFHEFSGLNDSRLVHPFSH-- 784

  Fly   402 IKIVIWKPEYEMLLFFSENMEKYSSIFQLQEDYKEFLHLRDSFDTRYGYMMPMEKWSLMKEQQRV 466
                  ||.:           |:.:|.....|..    :...|:..:.||....|.|:......|
  Fly   785 ------KPSF-----------KFGTIPYSHTDST----IHKYFNVMHNYMRQYNKTSVADGVAAV 828

  Fly   467 FSSPLFSL------------QDDLCVFHTVPIVFPMV-------KNSIFKEPFDRLILDVTATGL 512
            .:..|.|.            ||:.|...||...:.|.       :||.:.:.|::.:|:..|.|.
  Fly   829 LNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGD 893

  Fly   513 LSRWRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGDLIQIWRFVG----WMLG--LATIVFLLEL 571
            |.|.|....|...:.|:            :..|..|.:.:.:|:.    .|.|  ||.::.|||.
  Fly   894 LERLRRYWMTGTCRPGK------------QEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEH 946

  Fly   572 ICF 574
            :.|
  Fly   947 VYF 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
Nmdar2NP_001014714.1 PBP1_iGluR_NMDA_NR2 99..490 CDD:107373
PBP2_iGluR_NMDA_Nr2 502..908 CDD:270436 66/338 (20%)
Lig_chan 665..928 CDD:278489 61/324 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.