DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and Grik3

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001106187.1 Gene:Grik3 / 298521 RGDID:71027 Length:919 Species:Rattus norvegicus


Alignment Length:256 Identity:55/256 - (21%)
Similarity:85/256 - (33%) Gaps:81/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LPVSVLQIKEHSRETYSLLENPSHNVLTIAFVNDSPEDILEILYRNLRMLNTQPVLLVIRK---- 115
            |.||:|..|.:.       .|||    ..:|:|....||.  :|..|..|....||.||.:    
  Rat   538 LGVSILYRKPNG-------TNPS----VFSFLNPLSPDIW--MYVLLAYLGVSCVLFVIARFSPY 589

  Fly   116 -----------STIRVN--SLLEWCWH---------HQLL------KVVAIAQDFMESLIVYSYN 152
                       |.:..|  :||...|.         .:|:      :::.....|...:|:.||.
  Rat   590 EWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYT 654

  Fly   153 ----PFPVLQFIERRLDN------------------STVIFEKRLENLHGYEVPIALGGSSPRLI 195
                .|..::.:|..:|:                  :|:.|.|: ..:..:|...|...|.|..:
  Rat   655 ANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKK-SKISTFEKMWAFMSSKPSAL 718

  Fly   196 VYRDLEG-KLIFSGPVGNFMKSFEQRY----NCRLVQ--------PYPFDESAISPARDLI 243
            |..:.|| :...:......|:|....|    ||.|.|        .|.......||.||.|
  Rat   719 VKNNEEGIQRTLTADYALLMESTTIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKI 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
Grik3NP_001106187.1 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 55/256 (21%)
Lig_chan 564..832 CDD:278489 45/219 (21%)
Glutamate binding 690..692 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.