DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and Grik1

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001104587.1 Gene:Grik1 / 29559 RGDID:2732 Length:949 Species:Rattus norvegicus


Alignment Length:225 Identity:47/225 - (20%)
Similarity:88/225 - (39%) Gaps:34/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 SQSFYEVL-----RAPALIKAMYLVICLLGLLITSWYNSYFSTFVTSAPRFPQLTSYESIRHSNI 402
            |:.||.:.     .|..::|.    |..:|:: |.:|:.:|:|....|... :|..|..:..:..
  Rat   222 SKEFYVIFDCSHETAAEILKQ----ILFMGMM-TEYYHYFFTTLDLFALDL-ELYRYSGVNMTGF 280

  Fly   403 KIV-IWKPEYEMLLFFSENMEKYSSIFQLQEDYKEFLHLRDSFDTRYGYMMPMEKWSLMKEQQRV 466
            ::: |..|....::      ||: |:.:||...:....|.|...|....:|....:.:.....|.
  Rat   281 RLLNIDNPHVSSII------EKW-SMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRA 338

  Fly   467 FSSPLFSLQDDLCVFHTVPIVFPMVKNSIFKEPFDRLILDVT--ATGLLSRWRDMSFTEMIKAGQ 529
            ....:.|||   |..|....:.|...|.|.:..:|.|...:|  .|..|.:..|:..        
  Rat   339 SQLTVSSLQ---CHRHKPWRLGPRFMNLIKEARWDGLTGRITFNKTDGLRKDFDLDI-------- 392

  Fly   530 LGLEDRGHPKEFRAMKVGDLIQIWRFVG-W 558
            :.|::.|..|....:. ..|.::|:.:| |
  Rat   393 ISLKEEGTEKASGEVS-KHLYKVWKKIGIW 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
Grik1NP_001104587.1 Periplasmic_Binding_Protein_Type_1 35..430 CDD:299141 47/225 (21%)
ANF_receptor 53..396 CDD:279440 40/197 (20%)
Periplasmic_Binding_Protein_Type_2 446..815 CDD:304360
Glutamate binding 531..533
Lig_chan 577..846 CDD:278489
Glutamate binding 704..705
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.