DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and GRIK3

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_000822.2 Gene:GRIK3 / 2899 HGNCID:4581 Length:919 Species:Homo sapiens


Alignment Length:351 Identity:70/351 - (19%)
Similarity:113/351 - (32%) Gaps:121/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVALVLLSP------------GGDSFYH---SLIHHLNRELKIEYVLLL---GNFDT-----TW 48
            |:|..||..|            |.|.|..   .|:..|...|...|.:.|   |.:..     .|
Human   436 LIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQW 500

  Fly    49 LDILWQL----------PVSVLQIKEHSRE--------TYSLL------ENPSHNVLTIAFVNDS 89
            ..::.:|          |:::..::|.:.:        ..|:|      .|||    ..:|:|..
Human   501 NGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPS----VFSFLNPL 561

  Fly    90 PEDILEILYRNLRMLNTQPVLLVIRK---------------STIRVN--SLLEWCWH-------- 129
            ..||.  :|..|..|....||.||.:               |.:..|  :||...|.        
Human   562 SPDIW--MYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQ 624

  Fly   130 -HQLL------KVVAIAQDFMESLIVYSYN----PFPVLQFIERRLDN----------------- 166
             .:|:      :::.....|...:|:.||.    .|..::.:|..:|:                 
Human   625 GSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKD 689

  Fly   167 -STVIFEKRLENLHGYEVPIALGGSSPRLIVYRDLEG-KLIFSGPVGNFMKSFEQRY----NCRL 225
             :|:.|.|: ..:..:|...|...|.|..:|..:.|| :...:......|:|....|    ||.|
Human   690 GATMTFFKK-SKISTFEKMWAFMSSKPSALVKNNEEGIQRALTADYALLMESTTIEYVTQRNCNL 753

  Fly   226 VQ--------PYPFDESAISPARDLI 243
            .|        .|.......||.||.|
Human   754 TQIGGLIDSKGYGIGTPMGSPYRDKI 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
GRIK3NP_000822.2 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 70/351 (20%)
Lig_chan 564..832 CDD:278489 45/219 (21%)
Glutamate binding. /evidence=ECO:0000250 690..692 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.