DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and Grin3b

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:208 Identity:47/208 - (22%)
Similarity:82/208 - (39%) Gaps:69/208 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 RLVQPYPFDESAISPARDLIASVQNGSVQIALGAIYPQVPYTGYSYPIELMSWCLMMPVPEEVPH 288
            |:|:.:|      .|.|  :.:....||::|  |:.|:.|    :....::: .|..|.| .:||
  Rat    20 RVVRGHP------QPCR--VPTRAGASVRLA--ALLPRAP----AARARVLA-ALATPAP-RLPH 68

  Fly   289 SQLYSM--VFSP------MAFGITIVAM---VLISLTLSMA---LRLHGYRVSFSEYFLHDSCLR 339
            :....:  |.||      :|.|:..|..   |:.|:....|   |||..:..:.:|     :.:.
  Rat    69 NLSLELVAVASPTRDPASLARGLCQVLAPPGVVASIAFPEARPELRLLQFLAAATE-----TPVV 128

  Fly   340 GVLSQSFYEVLRAP---------------------ALIKA-----MYLVICLL---GLLITSWYN 375
            .||.:.....|.||                     :|::|     :.||:|.:   |.|:|.|.|
  Rat   129 SVLRREVRTALGAPTPFHLQLDWASPLETILDVLVSLVRAHAWEDIALVLCRVRDPGSLVTLWTN 193

  Fly   376 SYFSTFVTSAPRF 388
                 ..:.||:|
  Rat   194 -----HASQAPKF 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372 46/207 (22%)
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438
Lig_chan 576..842 CDD:278489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.