Sequence 1: | NP_001138099.1 | Gene: | Ir94d / 7354412 | FlyBaseID: | FBgn0259193 | Length: | 593 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_579842.2 | Gene: | Grin3b / 170796 | RGDID: | 621705 | Length: | 1002 | Species: | Rattus norvegicus |
Alignment Length: | 208 | Identity: | 47/208 - (22%) |
---|---|---|---|
Similarity: | 82/208 - (39%) | Gaps: | 69/208 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 224 RLVQPYPFDESAISPARDLIASVQNGSVQIALGAIYPQVPYTGYSYPIELMSWCLMMPVPEEVPH 288
Fly 289 SQLYSM--VFSP------MAFGITIVAM---VLISLTLSMA---LRLHGYRVSFSEYFLHDSCLR 339
Fly 340 GVLSQSFYEVLRAP---------------------ALIKA-----MYLVICLL---GLLITSWYN 375
Fly 376 SYFSTFVTSAPRF 388 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir94d | NP_001138099.1 | None | |||
Grin3b | NP_579842.2 | PBP1_iGluR_NMDA_NR3 | 21..405 | CDD:107372 | 46/207 (22%) |
PBP2_iGluR_NMDA_Nr3 | 414..808 | CDD:270438 | |||
Lig_chan | 576..842 | CDD:278489 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 882..910 | ||||
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 | 951..984 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166350192 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |