DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94d and GRIN3A

DIOPT Version :9

Sequence 1:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_597702.2 Gene:GRIN3A / 116443 HGNCID:16767 Length:1115 Species:Homo sapiens


Alignment Length:236 Identity:48/236 - (20%)
Similarity:93/236 - (39%) Gaps:50/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 SVQIALGAIYPQVPYTGYSYPIELMSWCLMMPVPEEVPHSQLYSMVFSPMAFGITIVAMVLISLT 314
            :::..||.: |.:|::..|.|.....:..:..|...|....:.:::..|.:.| .::.:.|:||.
Human   153 AIEAGLGDL-PLLPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQG-EMMELDLVSLV 215

  Fly   315 LS---MALRLHGY-RVSFSEYFLHDSCLRGVLSQSFYEVLRAPALIKAMY---LVIC-----LLG 367
            |.   :::..|.: |.|.:...|..|....:.|.:  :|..:...:...|   |::|     :..
Human   216 LHIPVISIVRHEFPRESQNPLHLQLSLENSLSSDA--DVTVSILTMNNWYNFSLLLCQEDWNITD 278

  Fly   368 LLITSWYNSYFS-----TFVTSAPRFPQLTSY-----ESIRHSNIKIVIWKPEYEMLLFFSENME 422
            .|:.:..||.|.     ....:.|....|.|:     |||::|...:|:          |..:||
Human   279 FLLLTQNNSKFHLGSIINITANLPSTQDLLSFLQIQLESIKNSTPTVVM----------FGCDME 333

  Fly   423 KYSSIFQLQEDYKEFLHLRDSFDTRYGYMMPMEKWSLMKEQ 463
            ....||::              .|::|.|.|..:|.|...|
Human   334 SIRRIFEI--------------TTQFGVMPPELRWVLGDSQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94dNP_001138099.1 None
GRIN3ANP_597702.2 PBP1_iGluR_NMDA_NR3 30..497 CDD:107372 48/236 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..118
ANF_receptor 127..469 CDD:279440 48/236 (20%)
PBP2_iGluR_NMDA_Nr3 512..908 CDD:270438
Lig_chan 676..942 CDD:278489
PPP2CB binding site. /evidence=ECO:0000250 951..987
GIT1-binding. /evidence=ECO:0000250|UniProtKB:Q9R1M7 1062..1095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.