DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42381 and CMC4

DIOPT Version :10

Sequence 1:NP_001137733.1 Gene:CG42381 / 7354409 FlyBaseID:FBgn0259727 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_878145.1 Gene:CMC4 / 1466503 SGDID:S000028514 Length:73 Species:Saccharomyces cerevisiae


Alignment Length:51 Identity:18/51 - (35%)
Similarity:28/51 - (54%) Gaps:6/51 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DPCKPNACRIQACLTKNHYQEDKCLDVLEAMRQCCLKWHKE------SLCC 51
            :||:..||.||.||..:.|.:.||..|::.:..||.|::.:      |.||
Yeast     3 NPCQKEACAIQDCLLSHQYDDAKCAKVIDQLYICCSKFYNDNGKDSRSPCC 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42381NP_001137733.1 MTCP1 8..58 CDD:430360 18/50 (36%)
CMC4NP_878145.1 MTCP1 4..61 CDD:430360 18/50 (36%)

Return to query results.
Submit another query.