| Sequence 1: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001354424.1 | Gene: | ANKRD44 / 91526 | HGNCID: | 25259 | Length: | 1074 | Species: | Homo sapiens |
| Alignment Length: | 244 | Identity: | 52/244 - (21%) |
|---|---|---|---|
| Similarity: | 81/244 - (33%) | Gaps: | 97/244 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 LHKHHTNFSTELENTINSESN-------FKNISNLIKFV-----RQHSKWYRDNDCINRHYFNYI 89
Fly 90 LLDP--RVTNNLKERASQL---HLMDV------WYTFLRAIFYVGKGKATRPYVHLKNAQKLVDE 143
Fly 144 TNNITLVKDPKLALIVSIWKANRG---VLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGF 205
Fly 206 YYGRARSLSDKERK------YLG----IALLYKLMMKFLAKEEKELFPL 244 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 17/77 (22%) |
| GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 27/128 (21%) | ||
| ANKRD44 | NP_001354424.1 | ANK 1 | 7..36 | 4/13 (31%) | |
| ANK 2 | 40..69 | 4/28 (14%) | |||
| ANK 3 | 73..102 | 9/28 (32%) | |||
| ANK 4 | 106..135 | 10/51 (20%) | |||
| ANK 5 | 139..168 | 7/47 (15%) | |||
| ANK 6 | 172..201 | 7/28 (25%) | |||
| ANK 7 | 205..234 | 3/6 (50%) | |||
| ANK 8 | 238..267 | ||||
| ANK 9 | 271..301 | ||||
| ANK 10 | 305..334 | ||||
| ANK 11 | 338..367 | ||||
| ANK 13 | 422..451 | ||||
| ANK 14 | 455..484 | ||||
| ANK 15 | 488..516 | ||||
| ANK 16 | 549..579 | ||||
| ANK 17 | 584..613 | ||||
| ANK 18 | 617..646 | ||||
| ANK 19 | 651..680 | ||||
| ANK 20 | 687..716 | ||||
| ANK 21 | 720..749 | ||||
| ANK 22 | 753..782 | ||||
| ANK 23 | 789..818 | ||||
| ANK 24 | 821..850 | ||||
| ANK 25 | 856..885 | ||||
| ANK 26 | 889..919 | ||||
| ANK 27 | 923..952 | ||||
| ANK 28 | 959..988 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||