DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and ANKRD30A

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	XP_011518059.1	Gene:	ANKRD30A / 91074	HGNCID:	17234	Length:	1585	Species:	Homo sapiens

Alignment Length:	82	Identity:	19/82 - (23%)
Similarity:	36/82 - (43%)	Gaps:	19/82 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 IQTIPLQLRN--NFKSKVKARPISYSLGT-LHKHHTNFSTELEN--------TINSESNFKNISN 63
            |.|..|:|::  .||::...:|.::...| :.|...|.:.||:|        .:.|||..|:.
Human   618 IPTKALELKDMQTFKAEPPGKPSAFEPATEMQKSVPNKALELKNEQTLRADEILPSESKQKDY-- 680

  Fly    64 LIKFVRQHSKWYRDNDC 80
                  :.:.|..::.|
Human   681 ------EENSWDTESLC 691

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105	11/52 (21%)
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401
ANKRD30A	XP_011518059.1	Ank_4	42..93	CDD:290365
		ANK repeat	42..70	CDD:293786
		ANK	67..192	CDD:238125
		ANK repeat	74..103	CDD:293786
		Ank_2	77..169	CDD:289560
		ANK repeat	105..136	CDD:293786
		ANK	133..253	CDD:238125
		ANK repeat	138..169	CDD:293786
		Ank_2	143..235	CDD:289560
		ANK repeat	171..202	CDD:293786
		ANK repeat	204..235	CDD:293786
		Ank_2	209..>278	CDD:289560
		ANK repeat	237..270	CDD:293786
		CCDC144C	1251..1540	CDD:291576
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165152077
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930