Sequence 1: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010227.1 | Gene: | MBP1 / 851503 | SGDID: | S000002214 | Length: | 833 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 76/195 - (38%) | Gaps: | 36/195 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSKLLVFNFIQTIPLQLRNNFKSKV-----KARPISYSLGTLHKHHTNFSTELENTINSESNFKN 60
Fly 61 ISNL--IKFVRQHSKWYRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVG 123
Fly 124 KGKATRPYVHLKNAQKLVDE----TNNITLVKD----PKLAL-----IVSIWKANRGVLLIRAFQ 175
Fly 176 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 16/65 (25%) |
GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 20/104 (19%) | ||
MBP1 | NP_010227.1 | KilA-N | 22..93 | CDD:367917 | |
ANKYR | 363..544 | CDD:223738 | |||
ANK repeat | 396..425 | CDD:293786 | |||
ANK repeat | 427..510 | CDD:293786 | |||
ANK repeat | 512..543 | CDD:293786 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |