DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and MBP1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_010227.1 Gene:MBP1 / 851503 SGDID:S000002214 Length:833 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:40/195 - (20%)
Similarity:76/195 - (38%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLLVFNFIQTIPLQLRNNFKSKV-----KARPISYSLGTLHKHHTNFSTELENTINSESNFKN 60
            ||.:...::| |.|.|:..|....:     ..:.::.....||:.|.|....|:.|:.|.|..|.
Yeast   598 MSPVSPSDYI-TYPSQIATNISRNIPNVVNSMKQMASIYNDLHEQHDNEIKSLQKTLKSISKTKI 661

  Fly    61 ISNL--IKFVRQHSKWYRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVG 123
            ..:|  ::.:::.||........|..:.....|..:.|..|::|..:         :.|.|    
Yeast   662 QVSLKTLEVLKESSKDENGEAQTNDDFEILSRLQEQNTKKLRKRLIR---------YKRLI---- 713

  Fly   124 KGKATRPYVHLKNAQKLVDE----TNNITLVKD----PKLAL-----IVSIWKANRGVLLIRAFQ 175
              |....|.......||:::    |.|.|:.||    .:|.|     ::.:.:.|:...|::.|:
Yeast   714 --KQKLEYRQTVLLNKLIEDETQATTNNTVEKDNNTLERLELAQELTMLQLQRKNKLSSLVKKFE 776

  Fly   176  175
            Yeast   777  776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 16/65 (25%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 20/104 (19%)
MBP1NP_010227.1 KilA-N 22..93 CDD:367917
ANKYR 363..544 CDD:223738
ANK repeat 396..425 CDD:293786
ANK repeat 427..510 CDD:293786
ANK repeat 512..543 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.