DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and TNKS2

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_005270242.2 Gene:TNKS2 / 80351 HGNCID:15677 Length:1190 Species:Homo sapiens


Alignment Length:187 Identity:38/187 - (20%)
Similarity:70/187 - (37%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NISNLIKFVRQHSKWYRDND----------CINRHYFNYILLDPRVTNNLKERASQLHLMDVW-Y 113
            |..::::::.||.......|          |...||        .|...|.:..:.:::.|:| :
Human   561 NRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHY--------EVAELLVKHGAVVNVADLWKF 617

  Fly   114 TFLRAIFYVGKGKATRPYVHLKN----AQKLVDETNNITLVKD----------PKLALIVSIWKA 164
            |.|...  ..|||.....:.|::    .:|..|....:.||||          ...||:.:   |
Human   618 TPLHEA--AAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDA---A 677

  Fly   165 NRGVLL----IRAFQGISSQDAQTREASIID-ALGMNHLTNRRLGFYYGRARSLSDK 216
            .:|.|.    :.:...::.:|.|.|.::.:. |.|.|:|........:|...:..||
Human   678 KKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDK 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 9/50 (18%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 29/134 (22%)
TNKS2XP_005270242.2 Ank_2 28..142 CDD:372319
ANK repeat 60..109 CDD:293786
PHA02876 <94..>479 CDD:165207
ANK repeat 111..142 CDD:293786
ANK repeat 144..175 CDD:293786
ANK repeat 234..262 CDD:293786
ANK repeat 264..295 CDD:293786
ANK repeat 297..328 CDD:293786
ANK repeat 386..418 CDD:293786
ANK repeat 420..451 CDD:293786
ANK repeat 453..482 CDD:293786
PHA03095 540..>826 CDD:222980 38/187 (20%)
ANK repeat 552..580 CDD:293786 3/18 (17%)
ANK repeat 582..613 CDD:293786 5/38 (13%)
ANK repeat 615..646 CDD:293786 7/32 (22%)
ANK repeat 668..698 CDD:293786 5/32 (16%)
ANK repeat 705..733 CDD:293786 5/27 (19%)
ANK repeat 735..766 CDD:293786 38/187 (20%)
ANK repeat 768..799 CDD:293786
SAM_tankyrase1,2 895..960 CDD:188923
tankyrase_like 962..1184 CDD:238718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.