DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and 4932414N04Rik

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006500398.1 Gene:4932414N04Rik / 75721 MGIID:1922971 Length:1106 Species:Mus musculus


Alignment Length:269 Identity:45/269 - (16%)
Similarity:90/269 - (33%) Gaps:103/269 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LRNNFKSKV---KARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKWYRDN 78
            :||.|..::   ||....|.: |..||     ..|....:||.|     ..:|:.          
Mouse   328 VRNGFIQQMHCGKASNHQYPV-TQKKH-----VRLTKKTSSEKN-----KALKYA---------- 371

  Fly    79 DCINRH--------------YFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATR 129
            |.::.|              |.|.:::..::..|.|:....|.:.|..:::        |....|
Mouse   372 DAMDDHQLSESLSEDYDLPDYDNILMIVDQLQMNYKDSGKPLEIQDAVHSY--------KMIVER 428

  Fly   130 PYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASI----- 189
            ...|   ::.|::::.|                |.|:|       ..:..:..:|.:|.:     
Mouse   429 NQNH---SELLIEKSKN----------------KRNQG-------HRVMKKPGETEKAKLQLRCR 467

  Fly   190 -----IDALGMNHLTNRRL------GFYYGRARSLSDK------ERKYLGIALLYKLMMKFLAKE 237
                 :|.|.:.....:.:      |:|....:.|::|      |::.|.:.         |..:
Mouse   468 REEQQLDLLDVGSPEKQDMQQRNPDGWYEEMKKELTEKDPQHGREKQQLELR---------LRAQ 523

  Fly   238 EKELFPLKN 246
            :.||..|:|
Mouse   524 DMELQHLRN 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 12/77 (16%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 18/124 (15%)
4932414N04RikXP_006500398.1 Smc <456..>687 CDD:224117 15/86 (17%)
DUF3496 620..699 CDD:371843
DUF3496 836..938 CDD:371843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.