DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Tnks2

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001157107.1 Gene:Tnks2 / 74493 MGIID:1921743 Length:1166 Species:Mus musculus


Alignment Length:235 Identity:53/235 - (22%)
Similarity:89/235 - (37%) Gaps:56/235 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKWYRDNDCINRHYFNYIL 90
            |:.|:.::.|...|....:.  |:|..|.::  ::...||..         .|.|...|      
Mouse    58 KSTPLHFAAGFGRKDVVEYL--LQNGANVQA--RDDGGLIPL---------HNACSFGH------ 103

  Fly    91 LDPRVTNNLKERASQLHLMDVW-YTFLR--AIFYVGKGKATRPYVHLKN-AQKLVDETNNITL-- 149
              ..|.|.|.:..:..:..|.| ||.|.  ||    |||.....|.|:: |:..:..|:..|.  
Mouse   104 --AEVVNLLLQHGADPNARDNWNYTPLHEAAI----KGKIDVCIVLLQHGAEPTIRNTDGRTALD 162

  Fly   150 VKDPKL-ALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMN-HLTNRR------LGFY 206
            :.||.. |::...:|.:.  ||..|..|     .:.:..:::..|.:| |.::.|      |...
Mouse   163 LADPSAKAVLTGDYKKDE--LLESARSG-----NEEKMMALLTPLNVNCHASDGRKSTPLHLAAG 220

  Fly   207 YGRARSLSDKERKYLGIALLYKLMMKFLAKEEKELFPLKN 246
            |.|.:.          :.||........||::.:|.||.|
Mouse   221 YNRVKI----------VQLLLHHGADVHAKDKGDLVPLHN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 12/63 (19%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 29/122 (24%)
Tnks2NP_001157107.1 ANK 1 23..52
Ank_4 28..78 CDD:290365 4/21 (19%)
ANK 50..164 CDD:238125 30/130 (23%)
ANK 2 57..86 7/29 (24%)
ANK repeat 60..88 CDD:293786 6/31 (19%)
Ank_2 62..154 CDD:289560 26/116 (22%)
ANK repeat 90..121 CDD:293786 8/47 (17%)
ANK 3 90..119 8/45 (18%)
ANK repeat 123..154 CDD:293786 12/34 (35%)
ANK 4 123..152 12/32 (38%)
ANK 203..317 CDD:238125 14/58 (24%)
ANK 5 210..239 6/38 (16%)
ANK repeat 213..241 CDD:293786 6/37 (16%)
Ank_2 215..307 CDD:289560 11/46 (24%)
ANK repeat 243..274 CDD:293786 4/8 (50%)
ANK 6 243..272 4/8 (50%)
ANK repeat 276..307 CDD:293786
ANK 7 276..305
ANK 8 363..395
ANK repeat 365..397 CDD:293786
Ank_2 368..461 CDD:289560
ANK 394..579 CDD:238125
ANK repeat 399..430 CDD:293786
ANK 9 399..428
ANK 10 432..461
ANK repeat 433..521 CDD:293786
Ank_2 437..556 CDD:289560
ANK 11 463..489
ANK 518..643 CDD:238125
ANK 12 525..554
ANK repeat 528..556 CDD:293786
Ank_2 530..622 CDD:289560
HIF1AN-binding. /evidence=ECO:0000250|UniProtKB:Q9H2K2 545..553
ANK repeat 558..589 CDD:293786
ANK 13 558..587
ANK repeat 591..622 CDD:293786
ANK 14 591..620
ANK 15 624..652
ANK repeat 644..674 CDD:293786
ANK 671..787 CDD:238125
ANK 16 678..707
ANK repeat 681..709 CDD:293786
Ank_2 683..775 CDD:289560
ANK repeat 711..742 CDD:293786
ANK 17 711..740
ANK repeat 744..775 CDD:293786
ANK 18 744..773
SAM_tankyrase1,2 871..936 CDD:188923
SAM 877..933 CDD:197735
tankyrase_like 938..1160 CDD:238718
PARP 952..1155 CDD:279038
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.