DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and Potegl

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	NP_081911.1	Gene:	Potegl / 70981	MGIID:	1918231	Length:	382	Species:	Mus musculus

Alignment Length:	133	Identity:	29/133 - (21%)
Similarity:	52/133 - (39%)	Gaps:	35/133 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly    60 NISNLIKFVRQHSKWYRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMD-VWYTFLRAIFYVG 123
            ||:.|:|.|:   .|                 :.::...|.|..:.||:.| :..|.|....|.|
Mouse   130 NITPLMKAVQ---SW-----------------EDKIVCFLLEHHANLHIKDSMGNTALHYAVYSG 174

  Fly   124 KGKATRPYVHLKNAQKLVDETNNI-TLVKDPKLALIVSIWKANR---GVLLIRAFQGISSQDAQT 184
                     :|..|.:|:....:| ...||....|:::: :.||   ...|:|....:.:.|:|.
Mouse   175 ---------NLATAARLLQYGADIEERTKDNLTPLLLAL-RENRLKMAQFLVRMEASVHAVDSQR 229

  Fly   185 REA 187
            |.:
Mouse   230 RNS 232

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105	7/40 (18%)
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	23/108 (21%)
Potegl	NP_081911.1	Ank_4	67..116	CDD:290365
		ANK	91..216	CDD:238125	24/115 (21%)
		ANK repeat	96..127	CDD:293786
		Ank_2	102..192	CDD:289560	19/90 (21%)
		ANK repeat	132..160	CDD:293786	8/47 (17%)
		ANK	158..281	CDD:238125	19/85 (22%)
		ANK repeat	162..193	CDD:293786	8/39 (21%)
		Ank_2	167..259	CDD:289560	17/76 (22%)
		ANK repeat	195..226	CDD:293786	6/31 (19%)
		ANK repeat	228..259	CDD:293786	2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167842153
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930