DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Poteg

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011240461.1 Gene:Poteg / 70952 MGIID:1918202 Length:1339 Species:Mus musculus


Alignment Length:208 Identity:44/208 - (21%)
Similarity:74/208 - (35%) Gaps:65/208 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TNFSTELENTINS--------ESNFKNISNLIKFVRQHSKWYRDNDCINRHYFNYILLD-PRVTN 97
            |...:.||:|.|.        |.| ..:.|.:..:: |.||:::| |..    .|:.|. |    
Mouse   647 TTVKSFLEDTSNDYPLSKPTVEKN-DYVPNEVSDIK-HGKWFQEN-CPK----EYVQLKLP---- 700

  Fly    98 NLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIW 162
             ::||.|          |.|....|.:.|..|           .||.   |.||:|         
Mouse   701 -IEERDS----------FPREAPPVNQAKLHR-----------ADEP---TSVKNP--------- 731

  Fly   163 KANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGFYYGRARSLSDKERKYLGIALLY 227
              :|....:|.....|.:.....:....|    :|..|:|:..:    :....|:.:||.:| .|
Mouse   732 --SRITRCVRQNAAASVKVTSVEDQKCPD----DHEKNQRMAAF----KRPQTKDTEYLSMA-NY 785

  Fly   228 KLMMKFLAKEEKE 240
            :....|...:|::
Mouse   786 ESRENFAEDQEED 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 16/67 (24%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 22/115 (19%)
PotegXP_011240461.1 ANK repeat 51..78 CDD:293786
ANK repeat 82..111 CDD:293786
Ank_2 85..176 CDD:372319
ANKYR 89..281 CDD:223738
ANK repeat 116..144 CDD:293786
ANK repeat 146..177 CDD:293786
ANK repeat 179..210 CDD:293786
ANK repeat 212..243 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.