DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Ankrd61

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_080008.1 Gene:Ankrd61 / 66729 MGIID:1913979 Length:421 Species:Mus musculus


Alignment Length:187 Identity:47/187 - (25%)
Similarity:69/187 - (36%) Gaps:57/187 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKG-------KATRPYVHL-------------- 134
            ::.||.|:.|.  |.|||..:..|:....|....|       :::...:|:              
Mouse   158 VNARVDNSNKH--SALHLAIIHGTYPVLSFLAQNGAQVNATNESSMTPLHMAADILNKNMIETLI 220

  Fly   135 ---KNAQKLVDETNNITLVKDPKLALIVSIWKANR----GV----LLIRAFQGISSQD--AQT-- 184
               .|....:..|.|..|    |||:..:..|..|    ||    ||:.....:::||  .||  
Mouse   221 AFGANVNCAISSTGNTAL----KLAVCTASSKVGRLLAAGVGCIRLLLNNGAQVNAQDHEGQTAL 281

  Fly   185 -------REASIIDAL-----GMNHLT-NRRLGFYYGRARSLSDKERKYLGIALLYK 228
                   ||| ||..|     .:|.|| |.....|....||.:.::|..|. .|||:
Mouse   282 HEACFGGREA-IISLLLEFEANVNILTRNGESPIYMYLQRSSNIRDRSLLA-RLLYR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 3/9 (33%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 38/157 (24%)
Ankrd61NP_080008.1 ANK 1 27..57
ANK <32..114 CDD:238125
ANK 2 74..103
ANK 78..220 CDD:238125 12/63 (19%)
ANK repeat 78..105 CDD:293786
Ank_2 79..197 CDD:289560 11/40 (28%)
ANK repeat 107..164 CDD:293786 2/5 (40%)
ANK 3 107..146
ANK 164..297 CDD:238125 32/139 (23%)
ANK 4 166..195 8/30 (27%)
ANK repeat 168..197 CDD:293786 7/30 (23%)
Ank_2 171..274 CDD:289560 20/106 (19%)
ANK repeat 199..274 CDD:293786 14/78 (18%)
ANK 5 199..228 2/28 (7%)
ANK 6 233..272 12/42 (29%)
Ank_5 262..316 CDD:290568 16/54 (30%)
ANK repeat 276..305 CDD:293786 8/29 (28%)
ANK 7 276..305 8/29 (28%)
ANK 8 309..342 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.