DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and HACE1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_065822.2 Gene:HACE1 / 57531 HGNCID:21033 Length:909 Species:Homo sapiens


Alignment Length:252 Identity:54/252 - (21%)
Similarity:85/252 - (33%) Gaps:59/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PLQL-RNNFKSKVKARPISYS----------LGTLHKHHTNFSTELENTINSESNFKNISNLIKF 67
            ||.| ..|.:.|..::.:.||          |..:|....|..|||.:.:....:..::.:.:..
Human   101 PLHLAARNGQKKCMSKLLEYSADVNICNNEGLTAIHWLAVNGRTELLHDLVQHVSDVDVEDAMGQ 165

  Fly    68 VRQHSKWYRDNDCINRHYFN-YILLD-------PRVTNNLKERASQLHLMDVWYTFLRAIFYVGK 124
            ...|..      |.|.|... ..|||       |.|:.     |:.|:            |....
Human   166 TALHVA------CQNGHKTTVQCLLDSGADINRPNVSG-----ATPLY------------FACSH 207

  Fly   125 GKATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLI----RAFQGI--SSQDAQ 183
            |:.....:.|....|.:.:.|.:|     .|.|.|.........:||    |.||.|  .:|:..
Human   208 GQRDTAQILLLRGAKYLPDKNGVT-----PLDLCVQGGYGETCEVLIQYHPRLFQTIIQMTQNED 267

  Fly   184 TREASIIDALGMNHLTNRRLGFYYGRARSLSD----KERKYLGIALLYKLMMKFLAK 236
            .||..:...|  .||:.:....|.....||::    ...|.|.::..|...||.|.:
Human   268 LRENMLRQVL--EHLSQQSESQYLKILTSLAEVATTNGHKLLSLSSNYDAQMKSLLR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 14/71 (20%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 28/128 (22%)
HACE1NP_065822.2 Ank_2 <27..>283 CDD:330894 45/211 (21%)
ANK 1 64..93
ANK repeat 66..95 CDD:293786
ANK 92..217 CDD:238125 26/138 (19%)
ANK repeat 97..128 CDD:293786 7/26 (27%)
ANK 2 97..126 7/24 (29%)
ANK repeat 130..161 CDD:293786 6/30 (20%)
ANK 3 130..159 6/28 (21%)
ANK repeat 163..194 CDD:293786 7/36 (19%)
ANK 4 163..192 7/34 (21%)
ANK 5 196..226 6/46 (13%)
ANK repeat 196..221 CDD:293786 5/41 (12%)
ANK 6 228..257 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..433
HECTc 554..903 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.