DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and ankef1a

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	NP_001020714.1	Gene:	ankef1a / 566413	ZFINID:	ZDB-GENE-041001-196	Length:	779	Species:	Danio rerio

Alignment Length:	119	Identity:	21/119 - (17%)
Similarity:	46/119 - (38%)	Gaps:	38/119 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    95 VTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYV------HLKNAQKLVD---ETNNITLV 150
            :.:.|.::.:.:.|:|:            :||....|.      |::..|.:::   :.||::
Zfish    98 IVSLLAKKNADMKLVDI------------EGKGVLFYCLHPTKRHMRCLQVVLNGNADVNNVS-- 148

  Fly   151 KDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLG 204
                        :|...|.|:...|   :||.:....||::.....:.||:..|
Zfish   149 ------------EAGIPVFLLACEQ---AQDCEGMCLSILERGADPNATNQETG 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105	1/5 (20%)
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	18/113 (16%)
ankef1a	NP_001020714.1	Ank_2	18..113	CDD:372319	2/14 (14%)
		ANK repeat	18..46	CDD:293786
		ANK repeat	49..80	CDD:293786
		ANK repeat	82..183	CDD:293786	18/113 (16%)
		PHA02874	85..>293	CDD:165205	21/119 (18%)
		ANK repeat	187..217	CDD:293786	1/1 (100%)
		Ank_2	191..283	CDD:372319
		ANK repeat	219..250	CDD:293786
		ANK repeat	252..283	CDD:293786
		ANK repeat	498..524	CDD:293786
		PHA02874	<508..>739	CDD:165205
		ANK repeat	529..557	CDD:293786
		Ank_2	531..623	CDD:372319
		ANK repeat	559..590	CDD:293786
		ANK repeat	592..623	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900