DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and caiap

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001020663.1 Gene:caiap / 557416 ZFINID:ZDB-GENE-041014-19 Length:744 Species:Danio rerio


Alignment Length:285 Identity:51/285 - (17%)
Similarity:75/285 - (26%) Gaps:126/285 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TINSESNFKNISNLIK-------------------FVRQHSKWY--------RDNDCINRHYFNY 88
            |:..|.|.:.::.||.                   .:.||.:.|        ||   ..|....|
Zfish    54 TVREEKNSRMLNILISRGERACRIFFYPCLKRAEPDLYQHMRTYVGGVNEGIRD---ARRQLIGY 115

  Fly    89 ILLDPR---VTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLV 150
            :|...:   |.|:..||   :|               .|..|..|.....|.|.|..|:|:...:
Zfish   116 LLEKDKQGLVKNSKPER---IH---------------PKSTANEPNNEPLNKQILKSESNHHDAI 162

  Fly   151 KDPKLALIVSIWKANRGVLLIRAFQGISSQDAQ-----TREASIIDALGMNHLTNRRLGFY---- 206
                                   .:.|||.|..     |:|..:...|..|.........|    
Zfish   163 -----------------------LEAISSGDLYLLQELTKELDVNSVLSSNDTLLHHAAEYGKEA 204

  Fly   207 -------YGRARSLSDKE----------RKYLGIALL--------------------------YK 228
                   .|....|.|||          |.:..:|:.                          ::
Zfish   205 IVYFLLRQGAKLDLKDKEGRTALHRAAQRGHTAVAVALAKAGADIHATDQTSKTPLHLAAQNGHE 269

  Fly   229 LMMKFLAKEEKELFPLKNTKAAMAA 253
            ..:|.|..|||:....:.|...|||
Zfish   270 GCVKALVHEEKKSLKNQTTVLHMAA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 15/79 (19%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 23/122 (19%)
caiapNP_001020663.1 CARD 15..94 CDD:260018 6/39 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..146 7/36 (19%)
ANK 1. /evidence=ECO:0000255 157..185 7/50 (14%)
ANK repeat 159..187 CDD:293786 6/50 (12%)
PHA03095 160..>577 CDD:222980 25/158 (16%)
ANK 2. /evidence=ECO:0000255 189..218 3/28 (11%)
ANK repeat 191..220 CDD:293786 3/28 (11%)
ANK repeat 222..253 CDD:293786 3/30 (10%)
ANK 3. /evidence=ECO:0000255 222..251 3/28 (11%)
ANK 4. /evidence=ECO:0000255 255..285 5/29 (17%)
ANK 5. /evidence=ECO:0000255 287..314 4/8 (50%)
ANK repeat 318..348 CDD:293786
ANK 6. /evidence=ECO:0000255 318..347
ANK 7. /evidence=ECO:0000255 377..406
ANK repeat 379..408 CDD:293786
ANK repeat 410..441 CDD:293786
ANK 8. /evidence=ECO:0000255 410..439
ANK 9. /evidence=ECO:0000255 443..472
ANK repeat 446..474 CDD:293786
PHA03095 463..>698 CDD:222980
ANK 10. /evidence=ECO:0000255 476..505
ANK repeat 478..507 CDD:293786
ANK repeat 509..540 CDD:293786
ANK 11. /evidence=ECO:0000255 509..538
ANK repeat 542..573 CDD:293786
ANK 12. /evidence=ECO:0000255 542..571
ANK repeat 575..606 CDD:293786
ANK 13. /evidence=ECO:0000255 575..604
ANK repeat 608..639 CDD:293786
ANK 14. /evidence=ECO:0000255 608..637
ANK repeat 641..674 CDD:293786
ANK 15. /evidence=ECO:0000255 643..672
ANK repeat 676..711 CDD:293786
ANK 16. /evidence=ECO:0000255 676..705
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.